(data stored in ACNUC13479 zone)

EMBL: CP002688.PE9

CP002688.PE9         Location/Qualifiers
FT   CDS_pept        complement(join(6309..6790,7212..7335,7440..7576,
FT                   7705..8139,8216..8270))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.5"
FT                   /gene_synonym="F7J8_5"
FT                   /locus_tag="AT5G01020"
FT                   /product="Protein kinase superfamily protein"
FT                   /note="Protein kinase superfamily protein; FUNCTIONS IN:
FT                   protein serine/threonine kinase activity, protein kinase
FT                   activity, kinase activity, ATP binding; INVOLVED IN:
FT                   protein amino acid phosphorylation, N-terminal protein
FT                   myristoylation; LOCATED IN: plasma membrane; EXPRESSED IN:
FT                   22 plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protein kinase, ATP binding
FT                   site (InterPro:IPR017441), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271); BEST Arabidopsis thaliana
FT                   protein match is: Protein kinase superfamily protein
FT                   (TAIR:AT2G05940.1); Has 117465 Blast hits to 116000
FT                   proteins in 4235 species: Archae - 97; Bacteria - 13843;
FT                   Metazoa - 43298; Fungi - 9750; Plants - 33095; Viruses -
FT                   372; Other Eukaryotes - 17010 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01020"
FT                   /db_xref="GOA:Q8GXZ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GXZ3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV542668.1,INSD:DR367882.1,INSD:EL166751.1,
FT                   INSD:AJ609355.1,INSD:BP604386.1,INSD:ES201609.1,
FT                   INSD:EH846774.1,INSD:EL064159.1,INSD:EL164792.1,
FT                   INSD:AV816823.1,INSD:DR384217.1,INSD:EL077815.1,
FT                   INSD:AV797668.1,INSD:AV542256.1,INSD:BP791525.1,
FT                   INSD:AV811734.1,INSD:EH968086.1,INSD:DR367880.1,
FT                   INSD:EL082000.1,INSD:BP595609.1,INSD:BP632365.1,
FT                   INSD:ES102947.1,INSD:EL986414.1,INSD:BP622018.1,
FT                   INSD:BP588566.1,INSD:BP782136.1,INSD:ES022685.1,
FT                   INSD:ES092126.1,INSD:BP842708.1,INSD:EH976832.1,
FT                   INSD:ES066402.1,INSD:AV802485.1,INSD:EH836279.1,
FT                   INSD:ES157759.1,INSD:EH800126.1,INSD:EH851418.1,
FT                   INSD:CK120262.1,INSD:AV796565.1,INSD:EL155280.1,
FT                   INSD:EL005719.1,INSD:AV548064.1,INSD:EL324324.1,
FT                   INSD:ES003251.1,INSD:BE524804.1,INSD:BP585141.1,
FT                   INSD:AV550934.1,INSD:EL122246.1,INSD:EH953542.1,
FT                   INSD:ES153720.1,INSD:BP639299.1,INSD:EL079478.1,
FT                   INSD:EL033061.1,INSD:BP590578.1,INSD:AU238791.1,
FT                   INSD:EL164496.1,INSD:EH861276.1,INSD:ES072473.1,
FT                   INSD:EL270504.1,INSD:DR367879.1,INSD:BP787589.1,
FT                   INSD:BP637739.1,INSD:EH978602.1,INSD:EH912905.1,
FT                   INSD:ES058180.1,INSD:ES192104.1,INSD:BP848471.1,
FT                   INSD:EL253453.1,INSD:EH861733.1,INSD:CD534902.1,
FT                   INSD:ES172155.1,INSD:BP779449.1,INSD:EG490591.1,
FT                   INSD:CB262176.1,INSD:BP830687.1,INSD:ES045525.1,
FT                   INSD:EG449293.1,INSD:AB015116.1,INSD:BP833138.1,
FT                   INSD:EL029423.1,INSD:AV543230.1,INSD:EH847199.1,
FT                   INSD:EH835634.1,INSD:AV538629.1,INSD:EH984307.1,
FT                   INSD:BP784060.1,INSD:EL166811.1,INSD:BP664332.1,
FT                   INSD:EL321014.1,INSD:EL999290.1,INSD:EL197413.1,
FT                   INSD:DR367881.1,INSD:EL982126.1,INSD:AV546210.1,
FT                   INSD:AV535079.1,INSD:AA042233.1,INSD:AV537963.1,
FT                   INSD:BP791271.1,INSD:ES140772.1,INSD:EL085367.1,
FT                   INSD:EG449294.1,INSD:ES154156.1,INSD:CK119614.1,
FT                   INSD:BU635172.1,INSD:BP784902.1,INSD:EH875908.1,
FT                   INSD:AV531031.1,INSD:BP842769.1,INSD:BP594979.1,
FT                   INSD:AV558877.1,INSD:DR367878.1,INSD:EH895128.1,
FT                   INSD:BP635372.1,INSD:BP605875.1,INSD:ES125260.1,
FT                   INSD:AI992536.1,INSD:EL176246.1,INSD:ES154423.1,
FT                   INSD:EH989465.1,INSD:EH908113.1,INSD:BP860122.1,
FT                   INSD:EH797563.1,INSD:DR367877.1,INSD:EL112964.1,
FT                   INSD:EH900171.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX831068.1,INSD:BX832571.1,INSD:AK117952.1"
FT                   /protein_id="AED90288.1"
FT                   /translation="MGNCGTRDEAAVFTPQAQAQQLQKKHSRSVSDLSDPSTPRFRDDS
FT                   RTPISYAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAVK
FT                   VLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMLRGSLENHLFR
FT                   KTTAPLSWSRRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAK
FT                   AGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLEMLTGRKSVDKTRP
FT                   SKEQNLVDWARPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMS
FT                   DVVETLEPLQCTGDALIPCATTTAGAAFAMGGVPDYRMHRRFAKNVGPGAICRSPNPNY
FT                   SPGGPAACRVR"
     atgggcaact gcggtactag agacgaggct gccgtcttca ctcctcaagc tcaagcccaa        60
     cagctccaga agaagcactc ccgatccgtc tcagatctga gcgatccatc cactcctcgc       120
     ttccgagacg actctcgcac tcctatttcg tatgcccaag tcatcccctt tactttgttt       180
     gagcttgaga ccatcaccaa gagcttccgc ccagattata tactcggaga aggtggtttc       240
     ggtaccgtct acaagggtta cattgatgac aatctccgcg tcggcctcaa gtctctccct       300
     gttgccgtca aggtccttaa caaggaggga ctccagggtc accgtgaatg gcttacagag       360
     gtcaacttcc tcggccaact ccgtcatccc aacctcgtca agcttattgg ttactgctgc       420
     gaggacgatc accgattact tgtttatgag ttcatgctgc gaggcagtct tgagaatcac       480
     ctatttcgaa aaaccacagc tccgctatct tggtctagaa ggatgatgat tgctcttgga       540
     gctgcgaaag gccttgcttt cctccacaat gctgaaagac cggttattta tagggatttc       600
     aagacttcca atatactgct tgactccgac tacaccgcca agctttcaga ttttggctta       660
     gctaaagctg gaccccaggg tgatgaaacc catgtatcaa ctcgagttat gggtacttat       720
     ggctatgctg ccccagaata tgtgatgact ggacacttga cggccagaag tgatgtatac       780
     agctttggag ttgttcttct agagatgttg acaggaagaa aatcagtgga taagacaaga       840
     cctagcaaag agcagaactt ggttgattgg gctcggccaa agctgaatga taaaagaaaa       900
     ctgctgcaga taattgaccc aagactggag aaccaatact ctgtcagggc agctcagaag       960
     gcatgcagct tggcgtatta ttgtcttagc cagaacccga aagctaggcc attgatgagc      1020
     gatgtggttg agactttgga acctttgcag tgtactggtg atgccctgat cccttgtgca      1080
     actactacag ctggagctgc atttgcaatg ggaggggtgc ctgattacag aatgcaccgg      1140
     aggtttgcaa agaacgttgg gccaggtgca atttgccggt cacccaatcc aaattattca      1200
     ccgggtggac ctgcagcatg cagagttcgg tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page