(data stored in ACNUC13479 zone)

EMBL: CP002688.PE90

CP002688.PE90        Location/Qualifiers
FT   CDS_pept        join(190953..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192215,
FT                   192296..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; CONTAINS InterPro DOMAIN/s:
FT                   Methyltransferase-16, putative (InterPro:IPR019410); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01470.1"
FT                   /db_xref="GOA:Q8LCT7"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LCT7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL141324.1,INSD:BE524948.1,INSD:DR296895.1,
FT                   INSD:EL272610.1,INSD:EL289005.1,INSD:DR381642.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086411.1,INSD:BX833040.1,INSD:BT025168.1"
FT                   /protein_id="AED90348.1"
FT                   /translation="MDIALFSPASLFAADGDSSDGETTETSQNFVERNHQFPGIELQIR
FT                   EFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRCLEIGSGTGALAIFLKKEFNLDITT
FT                   SDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDEFPISEPDWDLIIASDILLYVKQYP
FT                   NLIKSLTFLLKKYKPTNVVSPAEGADTELPRPVFLMSWRRRIGKDDESLFFTGCEEAGL
FT                   EVKHLGNRVYCIKLRESNL"
     atggacatcg ccctcttctc accggcgtcg ctctttgctg cagacggtga ctcctctgat        60
     ggagagacga cggagacgag ccagaacttc gttgagagaa atcatcagtt tcctggaatt       120
     gaactgcaaa ttcgggaatt tggtttccac cagctgaatg caaacttgct gtggccaggt       180
     acatttgcct ttgctgattg gttactgcag catcgatatt tgatcgaaag gcggcgctgt       240
     ctcgagatag gaagtggcac aggggcacta gctatatttc ttaagaaaga gtttaatctc       300
     gacataacta cttcagatta caatgatcaa gagattgaag acaatattgt tcataactgt       360
     attgcaaaca agattatccc ttctctgcct catatcaagc atacatgggg tgatgaattt       420
     ccaatttcgg aaccagattg ggatttgatc atagccagtg atatccttct atatgtgaaa       480
     cagtacccaa acttgattaa gtctctgact tttcttctca aaaaatacaa accaaccaat       540
     gtcgttagtc cagcagaagg agcagacaca gaactgcctc gtcctgtgtt cttaatgagc       600
     tggagacgaa gaattgggaa agacgatgag tctctattct ttacgggctg cgaagaagct       660
     ggcctggagg tgaagcatct cggaaaccga gtttattgta tcaagcttag agaaagcaac       720
     ctctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page