(data stored in ACNUC13479 zone)

EMBL: CP002688.PE91

CP002688.PE91        Location/Qualifiers
FT   CDS_pept        join(190953..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192134)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="GOA:A0A1P8BE89"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE89"
FT                   /protein_id="ANM69915.1"
FT                   /translation="MDIALFSPASLFAADGDSSDGETTETSQNFVERNHQFPGIELQIR
FT                   EFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRCLEIGSGTGALAIFLKKEFNLDITT
FT                   SDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDEFPISEPDWDLIIASDILLCKYPFP
FT                   IRFIGKLYIYIFTFGFSQM"
     atggacatcg ccctcttctc accggcgtcg ctctttgctg cagacggtga ctcctctgat        60
     ggagagacga cggagacgag ccagaacttc gttgagagaa atcatcagtt tcctggaatt       120
     gaactgcaaa ttcgggaatt tggtttccac cagctgaatg caaacttgct gtggccaggt       180
     acatttgcct ttgctgattg gttactgcag catcgatatt tgatcgaaag gcggcgctgt       240
     ctcgagatag gaagtggcac aggggcacta gctatatttc ttaagaaaga gtttaatctc       300
     gacataacta cttcagatta caatgatcaa gagattgaag acaatattgt tcataactgt       360
     attgcaaaca agattatccc ttctctgcct catatcaagc atacatgggg tgatgaattt       420
     ccaatttcgg aaccagattg ggatttgatc atagccagtg atatccttct atgtaaatac       480
     ccatttccca ttcgatttat cggaaaacta tacatataca tttttacatt cggtttttcg       540
     cagatgtga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page