(data stored in ACNUC13479 zone)

EMBL: CP002688.PE92

CP002688.PE92        Location/Qualifiers
FT   CDS_pept        192990..194231
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.1"
FT                   /locus_tag="AT5G01480"
FT                   /product="Cysteine/Histidine-rich C1 domain family protein"
FT                   /note="Cysteine/Histidine-rich C1 domain family protein;
FT                   FUNCTIONS IN: zinc ion binding; INVOLVED IN: intracellular
FT                   signaling pathway; LOCATED IN: cellular_component unknown;
FT                   CONTAINS InterPro DOMAIN/s: Protein kinase C-like, phorbol
FT                   ester/diacylglycerol binding (InterPro:IPR002219), DC1
FT                   (InterPro:IPR004146), Zinc finger, PHD-type
FT                   (InterPro:IPR001965), C1-like (InterPro:IPR011424); BEST
FT                   Arabidopsis thaliana protein match is:
FT                   Cysteine/Histidine-rich C1 domain family protein
FT                   (TAIR:AT2G02610.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01480"
FT                   /db_xref="GOA:Q9M026"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M026"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI994631.1,INSD:AA651112.1"
FT                   /protein_id="AED90351.1"
FT                   /translation="MHHLDHTPSDRLLCPVERIQKDKDGKVTTISGGIHYIIKSSYFIS
FT                   NAEDEKPVHLLSLILRNRKEDKVLSFTFCYVCQIALLGEAYYVYFCSYCPNYYHKECVE
FT                   SPSVFHSSDHPKHPLQLLWIPDMSLEEERDKRCCSCKRGVDALFYYCSICDFAVHMACA
FT                   GNPTSPTIDNPKRHKHTLHYFPRKSGLFCDVCALVDDSDYLYVCLLCDFIVHKRCVYLP
FT                   YVIKVSRHNHRLTFTPNLPYEEPTVTDCGVCHAKINENYGEYSCTKKGCVYAVHSRCAM
FT                   QSDVCDGKKLEGEPEEVYEDTKMFEEKGDGIIQHQSHPRHQLRLEKIFHDESHHCQACR
FT                   RPSYDHGGNVYRCMQCDDFIFHESCAYLPRTKQFMLHVHPLTLDPSYNFIDWFQCGKCY
FT                   RYSCGFRCMCSCAV"
     atgcatcatc ttgaccacac tccttccgat cgtctcttat gcccagtaga acgaattcaa        60
     aaagataaag atggcaaagt gacaacaatt agtgggggaa tccattacat aatcaaaagt       120
     tcctatttca tttctaacgc tgaagacgaa aagcctgttc atctcctctc cttgattctt       180
     cgcaaccgaa aagaagacaa ggtactatct tttacttttt gctatgtttg tcagatagca       240
     ctattaggtg aagcctatta cgtttacttc tgcagctatt gccccaatta ctaccacaaa       300
     gaatgtgttg agtctccttc cgtgtttcat tcctctgatc atccaaaaca tcctcttcaa       360
     cttctctgga ttcccgacat gtctttagaa gaagaacgtg ataaacgatg ttgttcttgt       420
     aaacgtggcg tagacgcact attttactat tgctctattt gcgattttgc agtccatatg       480
     gcatgtgcgg gaaatccaac atccccaacc attgacaatc caaaaaggca taagcatacc       540
     cttcattact ttcccaggaa atccggtctg ttttgcgatg tttgtgcgtt ggtggacgat       600
     tctgattact tatatgtatg tctcctatgt gatttcattg tccataaacg atgtgtctac       660
     ttaccatatg tcataaaggt gtctcgtcac aatcatcgtc tcacttttac tcccaatctt       720
     ccttacgaag aaccaacggt gacggattgt ggagtttgtc atgcaaagat aaacgaaaat       780
     tacggagaat actcttgcac taagaaggga tgcgtttatg cagtgcattc cagatgtgct       840
     atgcaaagtg atgtgtgtga cgggaaaaaa cttgaaggag agcctgaaga agtatatgaa       900
     gacactaaaa tgtttgagga gaaaggcgat gggattatac agcatcagag tcatccacgt       960
     caccaattga gacttgaaaa aatattccac gatgaaagcc atcattgtca agcgtgcaga      1020
     cgtccttctt atgatcatgg tggtaatgtg tatcgatgta tgcaatgtga tgatttcatt      1080
     tttcatgaat cgtgtgcata tcttcctcgt actaaacaat ttatgctaca tgttcatcca      1140
     ttgactctag atcccagtta caatttcata gattggttcc aatgtgggaa atgttatcgt      1200
     tactcttgcg gtttccggtg catgtgttcg tgtgccgtgt ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page