(data stored in ACNUC13479 zone)

EMBL: CP002688.PE98

CP002688.PE98        Location/Qualifiers
FT   CDS_pept        join(206797..206861,207453..207603,207703..207769,
FT                   207867..208101,208170)
FT                   /codon_start=1
FT                   /gene="AIRP2"
FT                   /gene_synonym="F7A7.40"
FT                   /gene_synonym="F7A7_40"
FT                   /gene_synonym="ABA Insensitive RING Protein 2"
FT                   /gene_synonym="AtAIRP2"
FT                   /locus_tag="AT5G01520"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; CONTAINS InterPro
FT                   DOMAIN/s: Zinc finger, RING-type, conserved site
FT                   (InterPro:IPR017907); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT3G47160.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01520"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01520.2"
FT                   /db_xref="GOA:Q9M022"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M022"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES200245.1,INSD:CB257492.1,INSD:T22636.1,
FT                   INSD:ES024579.1,INSD:ES004530.1,INSD:ES019253.1,
FT                   INSD:EH934658.1,INSD:BP843186.1,INSD:AV826358.1,
FT                   INSD:BP660462.1,INSD:EL295849.1,INSD:ES071674.1,
FT                   INSD:N96366.1,INSD:T43550.1,INSD:BP804842.1,
FT                   INSD:ES152097.1,INSD:AV564168.1,INSD:ES086864.1,
FT                   INSD:ES089210.1,INSD:ES113693.1,INSD:BP856644.1,
FT                   INSD:AV827590.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF370144.1,INSD:AY056355.1"
FT                   /protein_id="AED90355.1"
FT                   /translation="MRKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAA
FT                   HLFLFLLQWTDCHFAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQL
FT                   HGGITDVEERKQKEICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKVVLPTCNH
FT                   SMCINCYRN"
     atgcgaaaat cgttcaagga ttcactcaag gctcttgaag ctgatatcca gttcgccaac        60
     actctggcgt cagagtaccc agaggagtat gatggtggct acgttcagat gagattatct       120
     tacagcccgg cggctcatct ctttctcttc cttcttcagt ggactgattg tcatttcgct       180
     ggcgctttgg gcttgcttag gatccttatt tataaggcat atgttgatgg gaagaccaca       240
     atgtcgctac atgaacgcaa aactagtatc agagaattct atgatgtgtt gtttccttcg       300
     ctattgcaac ttcatggagg gatcaccgat gtagaagaaa ggaaacagaa ggagatatgc       360
     gacaaaagat accgtaaaaa ggacagaaca gataaaggaa agatgtcgga gatcgatttg       420
     gagagggaag aagagtgtgg aatctgcttg gagattcgaa acaaagttgt tcttcctacg       480
     tgcaatcact ccatgtgtat aaactgctac agaaactga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page