(data stored in ACNUC13479 zone)

EMBL: CP002688.PRA1.B5

CP002688.PRA1.B5     Location/Qualifiers
FT   CDS_pept        complement(241442..242113)
FT                   /codon_start=1
FT                   /gene="PRA1.B5"
FT                   /gene_synonym="F7A7.160"
FT                   /gene_synonym="F7A7_160"
FT                   /gene_synonym="prenylated RAB acceptor 1.B5"
FT                   /locus_tag="AT5G01640"
FT                   /product="prenylated RAB acceptor 1.B5"
FT                   /note="prenylated RAB acceptor 1.B5 (PRA1.B5); CONTAINS
FT                   InterPro DOMAIN/s: Prenylated rab acceptor PRA1
FT                   (InterPro:IPR004895); BEST Arabidopsis thaliana protein
FT                   match is: prenylated RAB acceptor 1.B4 (TAIR:AT2G38360.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9M012"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M012"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP561368.2,INSD:ES179858.1,INSD:EG451121.1,
FT                   INSD:CK120161.1,INSD:EG451124.1,INSD:AV789803.1,
FT                   INSD:BP790051.1,INSD:EL114233.1,INSD:EG451123.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT000918.1,INSD:AY090930.1"
FT                   /protein_id="AED90370.1"
FT                   /translation="MVSTNPPVLPISTTATDTTNQPPIVTAVVESQPPVVRAFVNGVTE
FT                   TVCGGLSRSRPWSELLDRSAFTKPDSLSEAGTRFRKNSSYFRVNYVCIVALILGFSLLA
FT                   HPFSLILLLCLAASWLFLYLFRPSDRPLILFGRSFSEYETLGGLILSTIAVIFFTSVGS
FT                   VLISALMIGIATICVHGAFRAPDDLFLDEQDHAASGFLSFIGVPAIPSVAPSASSAASP
FT                   V"
     atggtgtcaa caaatccccc tgttcttcca atttccacca ccgcaacaga caccaccaat        60
     cagcctccga ttgtaaccgc tgtggtggaa tcgcaacctc cagtcgtccg tgcatttgtc       120
     aacggtgtga ccgagacggt ctgtggtggt ctatctcgta gccgtccgtg gtcagagctc       180
     ctcgatcgat ccgctttcac aaagcctgac tctctctccg aggccgggac gcgattccgg       240
     aaaaattcct cttatttcag ggtgaattac gtttgcattg tcgctctgat ccttggtttc       300
     tctcttctcg cccacccatt ctctctcatc ctcctcctat gtctcgccgc ttcctggctc       360
     ttcctctacc tcttccgtcc atcagatcgt cctcttatcc tcttcggccg atctttctcc       420
     gaatacgaaa ctctcggtgg cctaatcctc tccacgatcg cagtgatctt cttcacaagc       480
     gtcggatctg tattgatatc cgctctcatg atcggaatag caacaatctg tgtccatggc       540
     gcctttagag ctcccgatga tctcttcctc gacgaacaag atcatgccgc ctccggattc       600
     ctctcattca tcggtgttcc cgcgatcccc tctgtagcac cctctgcctc ctcagcggct       660
     tcccccgtgt aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page