(data stored in ACNUC13479 zone)

EMBL: CP002688.RAPTOR2

CP002688.RAPTOR2     Location/Qualifiers
FT   CDS_pept        complement(join(294539..294880,294961..295042,
FT                   295152..295237,295386..295487,295583..295716,
FT                   295792..295952,296266..296392,296485..296802,
FT                   296909..297475,297716..297927,298030..298349,
FT                   298667..298777,298881..298964,299183..299284,
FT                   299378..299456,299537..299681,299813..299967,
FT                   300464..300603,300703..300819,300902..301060,
FT                   301140..301225,301317..301419,301495..301773))
FT                   /codon_start=1
FT                   /gene="RAPTOR2"
FT                   /gene_synonym="ATRAPTOR1A"
FT                   /gene_synonym="RAPTOR1A"
FT                   /gene_synonym="T20L15.40"
FT                   /gene_synonym="T20L15_40"
FT                   /locus_tag="AT5G01770"
FT                   /product="regulatory-associated protein of TOR 2 (RAPTOR2)"
FT                   /note="RAPTOR2 (RAPTOR2); FUNCTIONS IN: binding, nucleotide
FT                   binding; INVOLVED IN: cell growth; LOCATED IN: CUL4 RING
FT                   ubiquitin ligase complex; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 12 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Armadillo-like helical
FT                   (InterPro:IPR011989), WD40 repeat (InterPro:IPR001680),
FT                   Regulatory associated protein of TOR (InterPro:IPR004083),
FT                   WD40 repeat-like-containing domain (InterPro:IPR011046),
FT                   WD40-repeat-containing domain (InterPro:IPR017986),
FT                   WD40/YVTN repeat-like-containing domain
FT                   (InterPro:IPR015943), Armadillo-type fold
FT                   (InterPro:IPR016024), WD40 repeat, subgroup
FT                   (InterPro:IPR019781); BEST Arabidopsis thaliana protein
FT                   match is: HEAT repeat; WD domain, G-beta repeat protein
FT                   protein (TAIR:AT3G08850.1); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01770"
FT                   /db_xref="GOA:Q9LZW9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES059290.1,INSD:ES008809.1,INSD:ES198247.1,
FT                   INSD:EH921215.1,INSD:EH800654.1,INSD:EG424616.1,
FT                   INSD:EL998946.1"
FT                   /protein_id="AED90389.1"
FT                   /translation="MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIAS
FT                   PRVASSSYENLSAATSMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMC
FT                   LHITVDPPDVIKISPCARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVEL
FT                   DPTKDDVRKLCLSCRKYAKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSEL
FT                   DSWLKTPTIYVFDCSAARVILNAFAEGESSGPPKDCILLAACDVHETLPQSVEFPADVF
FT                   TSCLTTPINIALKWFCRRSLLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIA
FT                   WNVLPRELFQRLFRQDLLVASLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWDAWD
FT                   MAAEICLSQLPQFFLDPNTEFQPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLL
FT                   SQCHRYRALVLLGRFLDMGPWAVDLALSVGIYPCVVKLLQTTTIELRQILVFIWTKILA
FT                   LDKSCQVDLVKDRGHIYFIRFLDSSDAFPEQRAMAAFILAVIVDGYKRGQESCLEANLI
FT                   AVCLGHLEATQLCDPPPEPLFLQWLCLCLGKLWEDYLEAQIMGREANASENLIAGHTNL
FT                   LQVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDIIIKSLLDVVSDGSPLVRTE
FT                   VAVALARFAFGHKQHLKSVADSYWKPQNSLRTSLPSMAKFHDSGTSIVASSDMGSLTRA
FT                   SPDSQPVAREGRISSSLQEPFSGLMQGSPLADDSSLHSDVGIIHDGVSNGVVHQPRPLD
FT                   NAIYSQSVLAMFTLAKDPSPRIASLGRRVLSVIGIEQIVAKPSKSNGRPGEAASASHTP
FT                   LAGLVRSSSWFDMHTGHLPLTFRTPPVSPPQTSYLTGLRRVCSLELRPHLLGSPDSGLA
FT                   DPILGVSGSERSLLPQSTIYNWSCGHFSKPLLGGADANEEIAAQREEKKKFSLEHIAKC
FT                   QHSSISGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGF
FT                   DNNDFPDKGISNLCLVNELDDSLLLVASCNVPTLSRASFAIRIWKDYATKGRQKLVTGF
FT                   SSIQGQKPGASGLNAVVDWQQQSGYLYVSGESLSIMVWDLDKEQLVKSMPFESGCSVTA
FT                   LSASQVHGSQLAAGFADGSVRLYDVRTPDFLVCATRPHQRVEKVVGLSFQPGLDPAKIV
FT                   SASQAGDIQFLDLRRPKETYLTIDAHRGSLTALGVHRHAPIIASGSAKQLIKVFSLKGE
FT                   QLGIIKYHTSFMGQQIGPVSCLAFHPYQMLLAAGAAGSFVSLYTHHNTQLPR"
     atggcattag gggacttgat ggtctccagg ctctctcaat cttccgttac tgttgtcacc        60
     aatcacctct acgacgacga cgacaactgc gcctcctccg ctcacgatga ttcccgtgtg       120
     tccatcatcg cctctcccag agtcgcaagt agcagctatg agaacctctc cgccgccaca       180
     agcatggcat acttgcctca gactcttgtg ctctgtgacc ttagacacga cgacgcatcc       240
     gacatcgtcc aacccccaag atggcgcctt aaagagcgaa tgaaaacagg atgtgttgct       300
     ctagttatgt gtttgcacat tactgttgat ccccctgatg ttattaagat ttctccctgc       360
     gcaagactcg aatgctggat agatcctttt tctatgtttc ccccaagaag agctcttgag       420
     gctattggcc aaaacttgag cattcagtac gagagatggc tggctcgggc tcgatataaa       480
     gtcgaattgg atcctacaaa ggacgatgtc aggaagctct gcttgtcttg ccggaaatat       540
     gcaaagactg agagagtttt gtttcactat aacgggcatg gtgtccctaa acctacacct       600
     aatggtgaaa tctgggttta caataagaat tttacgcagt acattccctt gccagtcagc       660
     gagcttgatt cctggttgaa aacacccacc atttacgttt ttgactgctc tgctgctagg       720
     gtgatcctca atgccttcgc cgagggggaa tcttctggac ccccgaagga ctgtattcta       780
     ctggctgctt gtgatgtaca tgagacactt cctcagagtg ttgaatttcc agctgacgtt       840
     tttacttctt gcctcacaac acctattaat atcgcattga aatggttctg cagacgttct       900
     cttctgaaag aatttataga tgaatcactt attgatagaa ttcccggtcg ccaaaatgac       960
     cgtaaaacat tgttaggaga gttgaactgg atcttcactg cagtcacaga caccattgcc      1020
     tggaatgtgc ttccacgcga acttttccag agattattca gacaggactt gttggttgct      1080
     agccttttcc gaaatttctt actagctgag aggataatgc ggtccggaaa ttgtacccca      1140
     atatcacatc ctatgctacc tcctacgcat cagcatcata tgtgggatgc atgggacatg      1200
     gctgctgaaa tctgcctttc tcagcttcct caattttttc tggacccaaa tacggagttt      1260
     cagccaagtt catttttcac tgagcaactg acagcttttg aggtctggct ggatcatgga      1320
     tctgagcata agaagccacc agagcagtta cctattgttc ttcaggtctt acttagccag      1380
     tgccatcggt atcgtgctct ggtgcttctt ggaagatttc ttgatatggg tccttgggct      1440
     gtcgatttgg ccttatctgt tggaatatat ccttgcgtag tgaagctgct gcaaacaaca      1500
     actattgagc tacggcagat tcttgttttc atatggacaa agatcctagc acttgataag      1560
     tcctgtcaag ttgatcttgt gaaggaccgg ggccacatat atttcattcg atttttagat      1620
     agttctgatg cattcccaga acaacgtgct atggctgcgt ttattttggc tgttattgtc      1680
     gatggctaca aacgaggcca agaatcatgt cttgaagcta atttaattgc tgtttgtctg      1740
     gggcacctcg aagcaaccca actatgtgat ccaccgccag aaccattgtt tctacaatgg      1800
     ctttgtcttt gtcttggaaa gttgtgggag gactatttgg aggcccagat aatgggtagg      1860
     gaggcaaatg cttctgagaa tctaattgct ggccacacca atctcttgca ggtcagggct      1920
     gctgctgttt ttgccttggg taccttactt gatgttgggt ttgactctgg taaaggtgtt      1980
     tgtgatgaag aatttgatga tgatgaaaat atagttgaag atattatcat aaaaagtctc      2040
     ttagatgtag tttcagatgg gagcccgctt gtccgaacag aggttgctgt agctctcgca      2100
     cggtttgctt ttggacacaa acaacatcta aagtcagttg cagattcata ctggaagccc      2160
     caaaattctc tgcgaacttc tctcccttca atggccaagt ttcatgactc tgggacttca      2220
     atagttgctt cttcagacat gggttctctg actagagcta gccctgatag ccaaccagtg      2280
     gctcgtgaag gaaggatctc aagcagcctc caagaacctt tttccgggct aatgcaagga      2340
     tctccattag ctgatgactc ctccttgcat tctgatgttg gaatcatcca tgatggtgtc      2400
     agcaatggag ttgtccatca gccaagaccg ctggataatg ctatctattc gcagagtgtt      2460
     ctagctatgt ttaccttagc taaagatcca tctccacgta ttgcaagcct tgggcggcgt      2520
     gtgctttctg ttattgggat tgaacaaatt gttgcgaaac cctccaagtc caatggccga      2580
     ccaggtgaag cagcatcagc atctcacact cctctggctg gcctagttcg ctcatcctct      2640
     tggtttgaca tgcatacagg ccacctaccg ttaacattta ggactcctcc ggtaagccct      2700
     ccgcaaacaa gctatttaac tggactgagg agagtttgtt cgctagagct ccgacctcat      2760
     ctgctgggtt ctcccgactc tggattggct gatccgattt taggtgtaag cgggtctgaa      2820
     cggagtttgc ttccacaatc aactatctac aactggagct gtggtcactt ttccaaacct      2880
     cttcttggcg gagcagatgc taatgaagag atagcagccc aaagagaaga aaaaaaaaag      2940
     ttttcgctgg agcatattgc aaaatgccag cattcatcaa taagcgggct cagcaatatt      3000
     ccgattgcta attgggatac aaagtttgaa acgggaacaa agacggccct ccttcaccct      3060
     ttttctccta ttgtagttgc tgccgatgag aatgaacgga ttagggtgtg gaattacgag      3120
     gaagcaactc ttcttaatgg ctttgacaat aacgattttc ctgacaaagg aatttcaaat      3180
     ctctgccttg tcaatgaact tgatgactct ctgctacttg ttgcctcttg taatgttcca      3240
     actctttcca gagcgtcttt tgcaatccgt atatggaaag actacgcaac aaagggtaga      3300
     caaaaacttg tcacagggtt ttcgtcaatc caaggtcaga agcctggtgc aagtggcctg      3360
     aacgctgtcg tggactggca acaacagtca ggttacctgt atgtttctgg ggaatcgtta      3420
     tcaatcatgg tttgggacct ggataaagaa cagctcgtca aatctatgcc ctttgaatcc      3480
     gggtgcagcg tcacagccct ttcggcttct caagtgcatg ggagtcaact tgctgctggt      3540
     tttgcggatg gatctgtaag actctacgac gttcgcacac ctgactttct tgtgtgcgcc      3600
     actcggcctc atcagcgagt agaaaaagta gttggactca gctttcagcc tggactcgat      3660
     ccagcaaaga ttgtgagcgc atcacaagca ggtgacattc agtttctgga tctgagaaga      3720
     ccaaaggaga catacctgac tatagacgcg catagaggat cactgacagc attgggtgtt      3780
     catagacatg ctccaatcat agcgagcggg tcagcaaaac agctaataaa agtgttcagc      3840
     cttaaaggag agcaacttgg gatcataaag taccacactt ccttcatggg ccaacagatt      3900
     ggcccagtca gttgcctcgc ctttcaccct taccagatgt tgttagccgc aggggctgct      3960
     ggctccttcg tctccttata cacccaccac aacacacaat taccaagata g               4011
//

If you have problems or comments...

PBIL Back to PBIL home page