(data stored in ACNUC13479 zone)

EMBL: CP002688.RUS5

CP002688.RUS5        Location/Qualifiers
FT   CDS_pept        join(201702..201856,201940..202002,202088..202245,
FT                   202390..202490,202609..202679,202773..202819,
FT                   202900..202978,203082..203154,203269..203358,
FT                   203458..203517,203641..203754,203839..203899,
FT                   203969..204087,204183..204275,204906..205151)
FT                   /codon_start=1
FT                   /gene="RUS5"
FT                   /gene_synonym="F7A7.30"
FT                   /gene_synonym="F7A7_30"
FT                   /gene_synonym="ROOT UV-B SENSITIVE 5"
FT                   /locus_tag="AT5G01510"
FT                   /product="root UVB sensitive protein (Protein of unknown
FT                   function, DUF647)"
FT                   /note="ROOT UV-B SENSITIVE 5 (RUS5); CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF647
FT                   (InterPro:IPR006968); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function, DUF647
FT                   (TAIR:AT3G45890.1); Has 426 Blast hits to 424 proteins in
FT                   125 species: Archae - 0; Bacteria - 2; Metazoa - 111; Fungi
FT                   - 69; Plants - 183; Viruses - 0; Other Eukaryotes - 61
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:B6IDH3"
FT                   /db_xref="InterPro:IPR006968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IDH3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES069503.1,INSD:ES057259.1,INSD:BP790823.1,
FT                   INSD:EL076072.1,INSD:BP793599.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT050411.1,INSD:BX829823.1,INSD:BX830511.1"
FT                   /protein_id="AED90354.1"
FT                   /translation="MYCTLRFPLPLHIPQTRTMTSCQPKRRRVEHLRCSAQPSSIREDD
FT                   EDADDRRVGVERRISIVVERYGNGTSKRYFLDDDDSPLQGILEERETKPDNNSQSSNSS
FT                   ETNILWLPDVVRDFVFPSGFPGSVSDDYLDYMLWQFPTNITGWICNVLVTSSLLKAVGV
FT                   GSFSGTSAAATAAASAAAIRWVSKDGIGALGRLLIGGRFGSLFDDDPKQWRMYADFIGS
FT                   AGSFFDLATQLYPSQFLLLASTGNLAKAVARGLRDPSFRVIQNHFAISGNLGEVAAKEE
FT                   VWEVAAQLIGLGFGILIIDTPGLVKSFPFVLLTWTSIRLVHLWLRYQSLAVLQFNTVNL
FT                   KRARIIVESHVVHSVVPGYVDCNKRENILLWQRFMKPRIIFGVSLEELSGLEKSVSKVK
FT                   ALLKMYTKEKYILTLNKLNKDTEFSVSFKVNATSRDVLRCLWQAYWLEENMEESFKDKD
FT                   SVFHWLKQSLSEMDNKFDDFLFKLDTAGWNLRESNLKVPNQVLIDQESIPF"
     atgtactgta ctttgcgatt tcctttgcct cttcacattc cccaaactcg aacaatgacg        60
     tcctgtcagc cgaaacgacg ccgtgttgag cacttgcggt gctctgctca gcctagtagt       120
     attcgtgaag atgacgaaga tgccgatgat aggagagttg gagttgaaag acgaatttcg       180
     attgtggtgg agagatacgg aaatggcact tcaaaaagat attttctaga tgatgatgat       240
     tcccctttac aaggcattct cgaggagcgt gaaactaagc ctgataacaa ttctcagagc       300
     tctaattcct ccgaaacgaa cattctttgg cttccagatg ttgtcaggga ttttgttttc       360
     ccctcaggct ttcctgggtc tgtttcagat gattacttgg actatatgct gtggcagttc       420
     ccaaccaata ttactggctg gatttgtaat gtattagtca cgtcaagtct tctcaaggcg       480
     gttggggttg gctctttctc aggaacttct gctgccgcta ctgctgctgc ttctgctgca       540
     gccatcagat gggtgtccaa ggatggaatt ggagctcttg gccgtcttct tattggtgga       600
     cgttttggta gtctttttga tgatgatcct aagcaatggc gcatgtatgc agattttatt       660
     ggcagtgctg gaagcttctt tgatttggca acccagctat atccatccca gttcctactg       720
     ttggcatcca cgggaaatct tgccaaggct gtggctagag gattgagaga cccttcattc       780
     agggtgattc agaatcattt cgctatctca ggaaatcttg gagaggtagc agccaaggaa       840
     gaagtgtggg aagttgctgc gcagctaatt ggtcttggtt tcggcattct gatcattgac       900
     acgccgggcc ttgtaaagtc atttccgttt gtgttactta catggacgag cattagactt       960
     gttcacctct ggctacgcta ccagtcgctt gcagtcctac aatttaacac ggtaaatctc      1020
     aagcgtgctc gtatcatagt agaatctcat gttgtgcact cagttgtacc aggatatgtt      1080
     gactgcaaca agcgagaaaa cattttgctg tggcagaggt tcatgaaacc tcgaatcatc      1140
     tttggtgtat cccttgaaga gttgtctggt ctggagaaat ctgtttctaa ggtcaaggca      1200
     ctccttaaga tgtacacaaa ggagaaatat attcttacgt tgaataagtt gaacaaggat      1260
     actgagtttt ctgtgtcctt taaggtgaat gccacaagca gagacgtgtt gagatgcctt      1320
     tggcaagcat attggttaga ggagaacatg gaagaaagct ttaaagacaa ggatagtgtg      1380
     ttccactggc tgaagcaaag cttgtcggag atggacaaca agtttgatga tttcttgttc      1440
     aaattggata ctgctggatg gaatctacgt gaatctaact tgaaggttcc caaccaagtt      1500
     ctcatagacc aggaatctat ccctttctaa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page