(data stored in ACNUC13479 zone)

EMBL: CP002688.SAUR21

CP002688.SAUR21      Location/Qualifiers
FT   CDS_pept        320983..323007
FT                   /codon_start=1
FT                   /gene="SAUR21"
FT                   /gene_synonym="T20L15.100"
FT                   /gene_synonym="T20L15_100"
FT                   /gene_synonym="SMALL AUXIN UP RNA 21"
FT                   /locus_tag="AT5G01830"
FT                   /product="ARM repeat superfamily protein"
FT                   /note="ARM repeat superfamily protein; FUNCTIONS IN:
FT                   ubiquitin-protein ligase activity, binding; INVOLVED IN:
FT                   response to chitin; LOCATED IN: ubiquitin ligase complex;
FT                   EXPRESSED IN: root; CONTAINS InterPro DOMAIN/s: U box
FT                   domain (InterPro:IPR003613), Armadillo-like helical
FT                   (InterPro:IPR011989), Armadillo (InterPro:IPR000225),
FT                   Armadillo-type fold (InterPro:IPR016024); BEST Arabidopsis
FT                   thaliana protein match is: plant U-box 17
FT                   (TAIR:AT1G29340.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW3"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP620856.1,INSD:ES111102.1,INSD:BP608621.1,
FT                   INSD:T76464.1,INSD:AU036576.1,INSD:BP798947.1,
FT                   INSD:AU237885.1,INSD:BP610001.1,INSD:AA394623.1,
FT                   INSD:AU228988.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT015725.1,INSD:BT015367.1,INSD:AK229397.1"
FT                   /protein_id="AED90398.1"
FT                   /translation="MAVTLDSPSPARKRRPLVVGSFESPKLSSDTKLTRSLFLASHEIS
FT                   SMQPLPFILRRNSLSLIRKVKILASVFDELLLPRSQLVVYSQSAHLCFEEMQIVMQRIK
FT                   SLIDDCSRVSKLWLLLQIDIVAFNFHELVTDLSTVLDILPLHDFDLSDDAQDLISLLTK
FT                   QCSDSVQFVDARDVALRRKVTDTIAGIKHQISPDHSTLIKIFNDLGLSDSASLTDEIQR
FT                   LEDEIQDQIDDRSKSAAASLIGLVRYSKCVLYGPSTPAPDFRRHQSLSDANIPADFRCP
FT                   ITLELMRDPVVVATGQTYDRESIDLWIQSGHNTCPKTGQVLKHTSLVPNRALKNLIVLW
FT                   CRDQKIPFELYGDGGGEPAPCKEAVEFTKMMVSFLIEKLSVADSNGVVFELRALAKSDT
FT                   VARACIAEAGAIPKLVRYLATECPSLQINAVTTILNLSILEQNKTRIMETDGALNGVIE
FT                   VLRSGATWEAKANAAATLFSLAGVSAYRRRLGRKARVVSGLVDLAKQGPTSSKRDALVA
FT                   ILNLVAERENVGRFVEAGVMGAAGDAFQELPEEAVAVVEAVVRRGGLMAVSAAFSLIRL
FT                   LGEVMREGADTTRESAAATLVTMCRKGGSELVAEMAAIPGIERVIWEMIGAGTARGGRK
FT                   AASLMRYLRRWAAGDTHNTAAETQSIVVPTPSRIFSPVL"
     atggctgtta ctcttgattc tccttctccg gcgagaaaac gtcgcccttt ggtcgtcggg        60
     tcattcgaat ctccgaagct ttcttcagat accaaactga ctcggtctct gtttctggcg       120
     tctcatgaga tttcttctat gcagcctctc ccattcattc tccgacgcaa ttctctctcc       180
     ctcattcgca aagtgaagat attagcttcc gtcttcgatg agcttcttct ccctcgttcc       240
     caacttgtcg tctactctca atccgctcat ctctgcttcg aagaaatgca aatcgttatg       300
     caacgtatca agtctttgat cgatgactgt tctcgtgtta gcaaactctg gctactcttg       360
     cagatcgaca tcgttgcctt caactttcac gagcttgtca ccgatttatc caccgttctt       420
     gatattttac cgctccatga ctttgacctc agcgacgacg cccaagatct catctctctc       480
     cttacaaaac aatgctccga ttctgttcag ttcgtcgacg cccgcgacgt tgctctccgt       540
     cgtaaagtca ccgatacaat cgccgggatc aagcaccaga tctcaccgga tcactctact       600
     ctcatcaaga ttttcaacga ccttggttta tccgattctg ctagtttgac cgacgaaatt       660
     cagagattgg aagacgagat tcaggatcag atcgacgaca gatccaaatc cgcagccgcc       720
     tctcttatcg gactcgtccg ttactctaag tgcgtcttat acggtccctc cacgccggct       780
     ccagatttcc gccgccacca atccttatct gacgctaaca tccccgcgga tttccggtgt       840
     ccgatcaccc tcgagctgat gcgggatccg gtggtggttg ccaccggtca aacatacgat       900
     agagagtcca tcgatctttg gatccaatcg gggcataaca cgtgtccgaa aacaggtcaa       960
     gtcctcaaac acaccagcct cgtacctaac cgtgccttga agaacctcat cgttttgtgg      1020
     tgccgcgatc agaagatacc gttcgaatta tacggtgacg gcggcggaga acctgcgccg      1080
     tgcaaggagg cggtggagtt tacgaagatg atggtttcgt ttctcatcga gaagctctcc      1140
     gtggcagatt ctaacggtgt cgtgttcgag ctccgggcgc tcgcaaagtc agatactgtg      1200
     gcccgagcct gcatagccga ggctggagcc atacccaagc tggttcgtta tctagccaca      1260
     gagtgcccga gccttcagat aaacgccgtt acgacgatcc taaacctatc catcctggaa      1320
     cagaacaaaa cgaggatcat ggaaactgac ggagctttaa acggcgtcat cgaggttctt      1380
     cgttcgggtg ccacgtggga ggctaaggct aacgcagccg cgacattgtt cagtttggcg      1440
     ggcgtctcgg catacagaag aagactcggg agaaaagcac gtgtcgtaag cggattggtt      1500
     gacttggcta agcagggccc caccagctct aagagagacg cgctcgtggc gatcctaaac      1560
     ctggtggctg agagagagaa cgtggggagg ttcgttgagg ctggggtaat gggagccgca      1620
     ggagatgcat tccaggagct accggaggaa gcggtggctg tcgtggaggc ggtggtcagg      1680
     aggggaggac tcatggcggt ttctgccgct ttcagtttga ttcgactttt gggggaggtg      1740
     atgagagaag gagcggatac cacaagggag agtgcggcgg caacgctggt cacgatgtgt      1800
     cggaaaggag ggtcggagct agtggcggag atggcggcta ttccagggat agagagggtt      1860
     atatgggaga tgataggagc tggaacggcc aggggaggga ggaaagcggc gtcattgatg      1920
     agatatctaa gacggtgggc cgccggagat acccataaca cggcggcgga aacgcagagc      1980
     attgtagtgc caacgccaag taggattttt agtccagttt tatga                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page