(data stored in ACNUC13479 zone)

EMBL: CP002688.SQD2

CP002688.SQD2        Location/Qualifiers
FT   CDS_pept        complement(join(86907..87182,87414..87630,87724..87780,
FT                   87858..87935,88027..88114,88204..88287,88388..88443,
FT                   88525..88598,88701..88818,88892..88962,89103..89169,
FT                   89539..89885))
FT                   /codon_start=1
FT                   /gene="SQD2"
FT                   /gene_synonym="F7J8.200"
FT                   /gene_synonym="F7J8_200"
FT                   /gene_synonym="SULFOLIPID SYNTHASE"
FT                   /gene_synonym="sulfoquinovosyldiacylglycerol 2"
FT                   /locus_tag="AT5G01220"
FT                   /product="sulfoquinovosyldiacylglycerol 2"
FT                   /note="sulfoquinovosyldiacylglycerol 2 (SQD2); FUNCTIONS
FT                   IN: UDP-glycosyltransferase activity,
FT                   UDP-sulfoquinovose:DAG sulfoquinovosyltransferase activity,
FT                   transferase activity, transferring glycosyl groups;
FT                   INVOLVED IN: cellular response to phosphate starvation,
FT                   sulfolipid biosynthetic process, glycolipid biosynthetic
FT                   process; LOCATED IN: chloroplast, chloroplast envelope;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Glycosyl
FT                   transferase, group 1 (InterPro:IPR001296); BEST Arabidopsis
FT                   thaliana protein match is: UDP-Glycosyltransferase
FT                   superfamily protein (TAIR:AT5G59070.1); Has 35941 Blast
FT                   hits to 35876 proteins in 3155 species: Archae - 1250;
FT                   Bacteria - 26211; Metazoa - 142; Fungi - 236; Plants -
FT                   1690; Viruses - 2; Other Eukaryotes - 6410 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01220"
FT                   /db_xref="GOA:Q8S4F6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8S4F6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES088950.1,INSD:EL123674.1,INSD:ES100266.1,
FT                   INSD:AI999595.1,INSD:EG496269.1,INSD:EL073620.1,
FT                   INSD:EL275023.1,INSD:BP805010.1,INSD:BP847142.1,
FT                   INSD:ES113947.1,INSD:AV540845.1,INSD:EG496268.1,
FT                   INSD:EH907656.1,INSD:EG451757.1,INSD:AV784670.1,
FT                   INSD:EL122192.1,INSD:ES184102.1,INSD:EG451765.1,
FT                   INSD:ES114807.1,INSD:EL277212.1,INSD:BP791225.1,
FT                   INSD:EL203802.1,INSD:EG451746.1,INSD:EL172067.1,
FT                   INSD:EG473715.1,INSD:CD530520.1,INSD:AV811076.1,
FT                   INSD:EG451747.1,INSD:EL022787.1,INSD:EL252269.1,
FT                   INSD:EL019868.1,INSD:EL169646.1,INSD:AV823662.1,
FT                   INSD:BG459186.1,INSD:EG451763.1,INSD:DR353265.1,
FT                   INSD:AA651177.1,INSD:EL264514.1,INSD:EL027254.1,
FT                   INSD:ES059394.1,INSD:CD532372.1,INSD:EH796489.1,
FT                   INSD:EG451758.1,INSD:CB259028.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF454354.1,INSD:BT005796.1,INSD:AY045961.2,
FT                   INSD:BX830044.1"
FT                   /protein_id="AED90311.1"
FT                   /translation="MTTLSSINLSIPPHLLPSTTNTCSSSSATSCSPPRSSSFVLHSPL
FT                   SFGHRRLPISKKSKLRFCGVITKEAVSGSNDMTITQVREDDESEIDAPLLDPESLSKPR
FT                   RIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGARVIGSRSF
FT                   PCPYYQKVPLSLALSPRIISEIARFKPDIIHASSPGVMVFGALAIAKMLSVPIVMSYHT
FT                   HVPVYIPRYTFSWLVKPMWSIIRFLHRAADLTLVPSAAIGKDLIAAGATAANQLRLWNK
FT                   GVDSESFNPRFRSQEMRIRLSNGEPEKPLVIHVGRIGVEKSLELLKSVMDKLPEARIAF
FT                   IGDGPYKEDLEKLFTGMPAVFTGTLQGDELSQAYASGDVFVMPSESETLGLVVLEAMSS
FT                   GLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTKLRTLLHDRETREIIGKAARE
FT                   ETEKYDWRAATTKIRNEQYSAAIWFWRKKKVHVLGPINWLIKRLFPVPEGNV"
     atgacgactc tttcttctat aaatctctct atacctcctc atttgcttcc tagcacgact        60
     aacacttgtt cttcttcctc tgcaacctct tgttctcctc ccaggtcttc ttcttttgtt       120
     cttcattccc ctctttcgtt tggtcaccgg agattaccca ttagcaagaa aagcaagctc       180
     cgcttctgtg gagtgattac aaaggaagct gtttctgggt ccaacgatat gactattact       240
     caagtcagag aagatgacga atcggagatt gatgcgccgc ttctcgatcc tgagtcgctc       300
     tctaagccta ggagaattgc tctctttgtt gagccttctc cctttgccta tgtatccggc       360
     tacaaaaaca gattccagaa tttcattaga tacctccgtg aaatgggaga cgaggttata       420
     gtcgtgacga cacatgaagg tgttcctgaa gagttttatg gagccagagt cattggatca       480
     agaagcttcc cttgtcctta ttaccaaaag gttccactct cgcttgcgct tagtccaaga       540
     atcatctctg aaattgcacg gtttaagcct gacattatac acgcttcatc tcccggagtt       600
     atggtctttg gtgctctggc aatagcaaaa atgctatctg taccaatagt aatgtcttac       660
     cacacacacg tccctgtata catcccaaga tacactttta gttggttggt aaaaccaatg       720
     tggtctataa taaggttcct tcacagagcg gctgatctta cattagttcc ttctgctgcc       780
     attggaaaag atcttatagc agctggtgca actgcagcta atcaacttcg actttggaat       840
     aagggtgtcg attcagaaag cttcaatccc cgtttccgtt ctcaagaaat gcgtataaga       900
     ctgagtaatg gcgaaccaga aaagccacta gtgattcatg taggtcgcat tggcgtagaa       960
     aagagtttgg agcttttaaa gagtgtaatg gacaaattac ctgaagctcg gattgctttc      1020
     attggagatg gaccatacaa agaggatctt gagaagttgt ttaccggaat gccagcggtt      1080
     ttcactggaa cgttacaagg cgatgaactc tcacaagctt acgcaagtgg agatgtgttt      1140
     gtgatgccat cagagtcgga gacacttggc cttgtggttc ttgaagcaat gtcttcagga      1200
     cttcctgtcg tcgcggcccg tgccggtgga atccctgata taatccctga agatcaggag      1260
     ggaaaaaccg gatttttgtt caaccctgga gatgttgaag attgcgtgac aaaactgaga      1320
     actttactgc acgaccgtga aacaagagag atcattggaa aagcggcaag agaagagacc      1380
     gagaaatatg attggagagc agcaacgaca aagatacgca atgaacagta cagtgcagcg      1440
     atttggttct ggaggaaaaa gaaagttcat gttttgggac caatcaattg gttgattaaa      1500
     cgactgtttc cagtaccgga aggtaacgtg tag                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page