(data stored in ACNUC13479 zone)

EMBL: CP002688.SR1

CP002688.SR1         Location/Qualifiers
FT   CDS_pept        complement(313423..314751)
FT                   /codon_start=1
FT                   /gene="SR1"
FT                   /gene_synonym="ATCIPK14"
FT                   /gene_synonym="ATSR1"
FT                   /gene_synonym="CBL-INTERACTING PROTEIN KINASE 14"
FT                   /gene_synonym="CIPK14"
FT                   /gene_synonym="serine/threonine protein kinase 1"
FT                   /gene_synonym="SERINE/THREONINE PROTEIN KINASE 1"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.15"
FT                   /gene_synonym="SnRK3.15"
FT                   /gene_synonym="T20L15.90"
FT                   /gene_synonym="T20L15_90"
FT                   /gene_synonym="PKS24"
FT                   /gene_synonym="SOS2-like protein kinase 24"
FT                   /locus_tag="AT5G01820"
FT                   /product="serine/threonine protein kinase 1"
FT                   /note="serine/threonine protein kinase 1 (SR1); FUNCTIONS
FT                   IN: protein serine/threonine kinase activity, protein
FT                   kinase activity, kinase activity, ATP binding; INVOLVED IN:
FT                   signal transduction, protein amino acid phosphorylation;
FT                   LOCATED IN: vacuole; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), NAF/FISL domain
FT                   (InterPro:IPR018451), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), NAF domain
FT                   (InterPro:IPR004041), CBL-interacting protein kinase
FT                   (InterPro:IPR020660), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636); BEST Arabidopsis thaliana
FT                   protein match is: SOS3-interacting protein 4
FT                   (TAIR:AT2G30360.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="PDB:2ZFD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG508678.1,INSD:AV810130.1,INSD:BP812529.1,
FT                   INSD:CB259689.1,INSD:ES129059.1,INSD:BP834022.1,
FT                   INSD:EH854951.1,INSD:ES014287.1,INSD:DR339470.1,
FT                   INSD:H37465.1,INSD:EL341569.1,INSD:CB257243.1,
FT                   INSD:CD529105.1,INSD:CD530616.1,INSD:EH848117.1,
FT                   INSD:BE527250.1,INSD:AV808027.1,INSD:T45283.1,
FT                   INSD:BP647565.1,INSD:CB260079.1,INSD:BP829028.1,
FT                   INSD:CB259979.1,INSD:ES134390.1,INSD:ES137442.1,
FT                   INSD:BE522098.1,INSD:ES142224.1,INSD:AV566674.1,
FT                   INSD:AV818150.1,INSD:ES179268.1,INSD:CB260648.1,
FT                   INSD:BE522099.1,INSD:BP834394.1,INSD:BP829967.1,
FT                   INSD:W43158.1,INSD:BP861006.1,INSD:EL205963.1,
FT                   INSD:EL016491.1,INSD:ES062448.1,INSD:CK118220.1,
FT                   INSD:CB255865.1,INSD:EL999478.1,INSD:AV830729.1,
FT                   INSD:ES086863.1,INSD:DR339471.1,INSD:CF773405.1,
FT                   INSD:EL994646.1,INSD:ES167392.1,INSD:H36240.1,
FT                   INSD:BP827495.1,INSD:AV812815.1,INSD:BP646669.1,
FT                   INSD:EL011114.1,INSD:AV558457.1,INSD:BP561730.2,
FT                   INSD:ES010780.1,INSD:ES134325.1,INSD:EL180254.1,
FT                   INSD:BP777505.1,INSD:N96318.1,INSD:EH858888.1,
FT                   INSD:EL095292.1,INSD:EG508668.1,INSD:AV809753.1,
FT                   INSD:CB255566.1,INSD:CB255570.1,INSD:AV439652.1,
FT                   INSD:BP648276.1,INSD:CB260946.1,INSD:BP847557.1,
FT                   INSD:AV831909.1,INSD:EG508679.1,INSD:ES052278.1,
FT                   INSD:EL174264.1,INSD:EG428947.1,INSD:EG428948.1,
FT                   INSD:ES043670.1,INSD:BP779716.1,INSD:ES170934.1,
FT                   INSD:AV521433.1,INSD:DR365707.1,INSD:AV798221.1,
FT                   INSD:AV553225.1,INSD:ES175977.1,INSD:ES157234.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AB035147.1,INSD:BX829749.1,INSD:BX830122.1,
FT                   INSD:AF360189.1,INSD:BX830723.1,INSD:BT015592.1,
FT                   INSD:AF295669.1,INSD:AY142684.1,INSD:BX829819.1"
FT                   /protein_id="AED90397.1"
FT                   /translation="MVDSDPVEFPPENRRGQLFGKYEVGKLVGCGAFAKVYHGRSTATG
FT                   QSVAIKVVSKQRLQKGGLNGNIQREIAIMHRLRHPSIVRLFEVLATKSKIFFVMEFAKG
FT                   GELFAKVSKGRFCEDLSRRYFQQLISAVGYCHSRGIFHRDLKPENLLLDEKLDLKISDF
FT                   GLSALTDQIRPDGLLHTLCGTPAYVAPEVLAKKGYDGAKIDIWSCGIILFVLNAGYLPF
FT                   NDHNLMVMYRKIYKGEFRIPKWTSPDLRRLLTRLLDTNPQTRITIEEIIHDPWFKQGYD
FT                   DRMSKFHLEDSDMKLPADETDSEMGARRMNAFDIISGSPGFNLSGLFGDARKYDRVERF
FT                   VSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEV
FT                   RKRQRAAASGRDLWTDTLRPFFVELVHESDQTDPEPTQVHTTS"
     atggtagatt ctgacccggt ggaatttccg ccggagaacc gccgtggaca gctcttcggc        60
     aaatacgagg tcggaaaatt ggtgggatgc ggcgccttcg cgaaagtgta ccacgggagg       120
     agcacagcga cgggtcagag cgttgcgatc aaagtggtga gcaagcaacg gctgcagaaa       180
     ggaggactca atggcaacat tcagagagag atcgctatca tgcaccgtct gcgccaccct       240
     tctatcgtgc gcctgttcga ggtcctcgcc accaaatcca agatcttctt cgtcatggaa       300
     ttcgccaagg gcggtgagct attcgccaaa gtctccaagg gcaggttctg cgaggatctt       360
     agccgtcgtt atttccagca gctcatctcc gccgtcggat attgccactc ccgcggcatc       420
     tttcaccgtg atctcaaacc ggagaatctc ctcctcgacg agaagctcga tttgaagatc       480
     tctgatttcg gactcagcgc tcttaccgat cagatccgac ccgacggcct cctccacaca       540
     ctctgtggta cgccggcgta cgtggcgcct gaggttttgg cgaagaaagg gtacgacggt       600
     gctaaaatcg acatatggtc atgtggaatc atactgttcg tcctcaacgc cggttatctc       660
     cctttcaacg accataatct catggttatg taccggaaaa tctacaaggg agaatttcgc       720
     attcccaagt ggacctcacc ggatctccgg cgactgctga ctcggctttt agacacgaat       780
     ccgcagacga ggatcactat cgaagagatc atccacgatc catggttcaa acagggctac       840
     gacgatcgga tgtctaaatt ccatctagag gactccgata tgaaactccc ggcggacgag       900
     accgacagcg agatgggagc aaggaggatg aacgcattcg acatcatctc aggatctcca       960
     gggttcaatc tctccggtct tttcggagac gccagaaagt acgaccgagt ggaacggttc      1020
     gtgtcggcgt ggacggcgga gagggtggtg gagaggctgg aggagatcgt gtcggcggag      1080
     aatctgacgg tggcgaagaa ggaaacatgg gggatgaaga tcgaggggca aaaaggtaac      1140
     ttcgcaatgg tggttgagat aaaccagcta acggacgagc tggttatgat agaggtgagg      1200
     aagagacaaa gagccgctgc atctggacga gatttatgga cagatacact caggcctttc      1260
     ttcgtcgagc ttgtgcacga atcagaccaa acggacccag aaccaactca agtacatacg      1320
     acgtcgtag                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page