(data stored in ACNUC13479 zone)

EMBL: CP002688.STN8

CP002688.STN8        Location/Qualifiers
FT   CDS_pept        join(359154..359714,359784..359957,360042..360446,
FT                   360520..360867)
FT                   /codon_start=1
FT                   /gene="STN8"
FT                   /gene_synonym="State transition 8"
FT                   /gene_synonym="STATE TRANSITION 8"
FT                   /gene_synonym="T20L15.190"
FT                   /gene_synonym="T20L15_190"
FT                   /locus_tag="AT5G01920"
FT                   /product="Protein kinase superfamily protein"
FT                   /db_xref="GOA:Q9LZV4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV4"
FT                   /protein_id="ANM70167.1"
FT                   /translation="MASLLSPATPTATSAAFHSCSTAGFSTPTHISSQNSSLSLLSRRG
FT                   CMMRCSFSPQDIPVDSLSHLPPFLDFQNSLATFSDTQKWGFFVSAGIVWFYLTARPGVL
FT                   IGAIDAYLLAPLQLGLDTLIGRRLKRSDFLVTEKLGEGSFGVVYAGVLLPKNSTLVDDV
FT                   RVSKARAKAMDFTGEFKQRVILKKVKVGVRGAEEFGEYEEWFNYRLSRAAPDTCAEFLG
FT                   SFVADKTNTMFTKGGKWLVWRFEGDRDLADYMKDRSFPSNLESIMFGRVLQGVESVKRR
FT                   ALIIKQIMRQIITSLRKIHGTGIVHRDVKPANLVVTKKGQIKLIDFGAAADLRIGKNYI
FT                   PERTLLDPDYCPPELYVLPEETPSPPPEPIAALLSPILWQLNSPDLFDMYSAGIVLLQM
FT                   AVPTLRSTAGLKNFNLEIKSVEYDLNRWRERTRTRPDLSILDLDSGRGWDLVTKLISER
FT                   GSLRRGRLSAAAALRHPYFLLGGDQAAAVLSKLSFSK"
     atggcctctc ttctctctcc cgccaccccc accgccacct ccgccgcatt tcattcctgc        60
     tccaccgccg gattctccac tcccactcac atttcatccc agaacagcag cctgtccctc       120
     ctcagccgcc ggggttgtat gatgagatgc agtttttctc cgcaggacat tcctgttgat       180
     tccctctctc atctccctcc tttccttgac tttcagaact ccctcgccac attttcggat       240
     acccagaaat gggggttctt tgtctccgcc ggaatcgtct ggttttacct cacggcgagg       300
     cctggtgttc tcatcggcgc cattgacgcc taccttctcg ctcccctcca gcttggcctc       360
     gacactctga ttggaaggag gttgaagagg tccgatttct tggtcactga gaaactcggc       420
     gaaggctctt tcggcgtcgt ctatgccggc gtcctactcc ccaagaattc tactcttgtt       480
     gatgacgtta gggttagcaa agcaagagct aaagcgatgg actttaccgg cgaattcaag       540
     cagagagtca tcctcaagaa ggtcaaggtg ggagtacgag gggccgagga atttggcgag       600
     tacgaagagt ggttcaacta ccgactctca agggccgctc ctgacacctg cgctgagttt       660
     ctcggaagct ttgtcgccga caagaccaat actatgttta ctaaaggcgg caaatggctt       720
     gtctggaggt tcgagggaga ccgtgatctc gctgattaca tgaaagatcg gagctttcct       780
     tctaatttgg agtccatcat gtttgggcgc gttctccaag gagtcgagtc tgtgaaacgt       840
     cgtgcactga tcattaagca gattatgcgc cagatcatta catctctcag gaaaatccat       900
     ggcacgggca ttgttcaccg ggacgtgaag cctgccaact tggtggttac aaagaagggc       960
     cagattaagc tcatcgactt tggtgccgct gctgatcttc gcattggcaa gaattacatc      1020
     ccggaacgca ctttactcga tcctgactac tgtcctcctg agctctatgt cctcccggag      1080
     gaaacgccaa gccctcctcc ggagcctata gccgctttgc tttccccgat tctctggcag      1140
     ttgaacagtc cggatctgtt tgatatgtat tctgctggga tagtgcttct ccaaatggcg      1200
     gttccgacct taagatctac tgccggtctg aagaatttta atctggagat caagtctgtt      1260
     gaatatgatc ttaataggtg gcgggaaagg actcggacga ggccagactt gagcatacta      1320
     gatctggact cgggcagagg gtgggacctc gtcactaaac tcatatccga gagaggttct      1380
     ctgagacgtg gacgcctttc agcagctgct gctctcagac acccttattt tttgttgggc      1440
     ggtgatcaag cggccgctgt tctttcaaag ctcagtttca gcaagtga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page