(data stored in ACNUC13479 zone)

EMBL: CP002688.TAAC

CP002688.TAAC        Location/Qualifiers
FT   CDS_pept        join(199017..199448,199804..199860,199958..200020,
FT                   200113..200169,200280..200363,200441..200509,
FT                   200586..200698,200783..200952,201036..201114,
FT                   201206..201329)
FT                   /codon_start=1
FT                   /gene="TAAC"
FT                   /gene_synonym="F7A7.20"
FT                   /gene_synonym="F7A7_20"
FT                   /gene_synonym="thylakoid ATP/ADP carrier"
FT                   /locus_tag="AT5G01500"
FT                   /product="thylakoid ATP/ADP carrier"
FT                   /note="thylakoid ATP/ADP carrier (TAAC); FUNCTIONS IN:
FT                   binding, transporter activity, ATP transmembrane
FT                   transporter activity; INVOLVED IN: photosystem II repair,
FT                   transport, photoprotection; LOCATED IN: in 7 components;
FT                   EXPRESSED IN: 27 plant structures; EXPRESSED DURING: 14
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Mitochondrial
FT                   carrier protein (InterPro:IPR002067), Mitochondrial
FT                   substrate carrier (InterPro:IPR001993), Mitochondrial
FT                   substrate/solute carrier (InterPro:IPR018108); BEST
FT                   Arabidopsis thaliana protein match is: Mitochondrial
FT                   substrate carrier family protein (TAIR:AT3G51870.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M024"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M024"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR381636.1,INSD:AV544656.1,INSD:AV526741.1,
FT                   INSD:AV784181.1,INSD:ES104469.1,INSD:AV823248.1,
FT                   INSD:DR348651.1,INSD:DR348650.1,INSD:BP785487.1,
FT                   INSD:BU634615.1,INSD:EL293347.1,INSD:ES048037.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT006336.1,INSD:BX831380.1,INSD:BX830301.1,
FT                   INSD:AY074566.1,INSD:AY086408.1,INSD:BX830063.1"
FT                   /protein_id="AED90353.1"
FT                   /translation="MGEEKSLLQFRSFPSLKTSDFALTEEPSWRLENNVSSNRRRGNKR
FT                   SGGVFTNFASLSVAIRRDRRESTFNGRNGGGGGAFASVSVVIPKEEDEFAPTSAQLLKN
FT                   PIALLSIVPKDAALFFAGAFAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIE
FT                   AITLIGKEEGIKGYWKGNLPQVIRIVPYSAVQLFAYETYKKLFRGKDGQLSVLGRLGAG
FT                   ACAGMTSTLITYPLDVLRLRLAVEPGYRTMSQVALNMLREEGVASFYNGLGPSLLSIAP
FT                   YIAINFCVFDLVKKSLPEKYQQKTQSSLLTAVVAAAIATGTCYPLDTIRRQMQLKGTPY
FT                   KSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIVKKLIAASEKEIQRIA
FT                   DDNRKKASPNTIDEQT"
     atgggagaag agaagtctct gcttcagttc cgtagttttc cttcactcaa gacctctgat        60
     ttcgctctca ccgaagaacc ttcatggagg ctggagaaca acgtgtcgtc gaatcgccgg       120
     agaggaaaca agagaagcgg tggcgttttt accaattttg cgtccctttc cgtagcgatt       180
     aggagagatc ggagagaatc tacatttaac ggtcgtaatg gcggcggagg cggagcgttc       240
     gcatcggttt cggtggtgat tccgaaggaa gaggatgaat tcgcgcctac ctcggcccag       300
     ctgttgaaaa accccattgc tttactgtcg atagtaccga aagacgccgc actattcttc       360
     gccggagcgt tcgccggagc cgccgcaaag tcagtgacgg caccgcttga ccgaataaag       420
     ctcctaatgc agacacatgg tgttcgagct gggcaacaaa gtgctaagaa ggctattggt       480
     ttcattgagg ccattactct tatcggaaag gaagaaggta ttaaaggtta ttggaaagga       540
     aatctacctc aggtgataag gattgtacct tatagcgcag tccagttgtt tgcatatgaa       600
     acatacaaga aactcttcag ggggaaagac ggtcaattgt cagtcctcgg aaggctcggt       660
     gctggtgctt gtgctggcat gacgtctact ctgattacat accctttaga tgtgctgaga       720
     ttgaggttag ctgttgaacc aggttatcga accatgtccc aggttgcctt gaacatgctg       780
     cgggaggaag gagttgcatc attctacaac ggtctaggtc cttcgctttt aagtatagct       840
     ccttacattg ccatcaactt ctgcgtcttt gatctggtaa agaaatctct gccagagaag       900
     tatcaacaaa agacacaatc atctttgtta acagcagtag tagctgctgc tattgctacc       960
     ggtacttgct atccattgga taccattaga aggcagatgc aattgaaggg tactccatat      1020
     aaatcggtat tagacgcttt ctcaggtatc attgcgcgtg aaggagttgt tggcttgtac      1080
     cgtggctttg tccccaatgc actcaaaagc atgccaaaca gcagtattaa gcttacaaca      1140
     ttcgacatcg tcaagaaact catagcagcg agtgagaagg agatccaaag aatcgcggat      1200
     gataaccgca agaaagcaag tcctaacaca atcgatgaac aaacctga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page