(data stored in ACNUC13479 zone)

EMBL: CP002688.TBL3

CP002688.TBL3        Location/Qualifiers
FT   CDS_pept        complement(join(147608..147941,148018..148376,
FT                   148502..148673,148764..149004,149118..149316))
FT                   /codon_start=1
FT                   /gene="TBL3"
FT                   /gene_synonym="T10O8.70"
FT                   /gene_synonym="T10O8_70"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 3"
FT                   /locus_tag="AT5G01360"
FT                   /product="trichome birefringence-like protein (DUF828)"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 3 (TBL3); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF231,
FT                   plant (InterPro:IPR004253); BEST Arabidopsis thaliana
FT                   protein match is: Plant protein of unknown function
FT                   (DUF828) (TAIR:AT3G55990.1); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01360"
FT                   /db_xref="GOA:Q8LED3"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="InterPro:IPR029972"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LED3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU235894.1,INSD:DR249278.1,INSD:AU226666.1,
FT                   INSD:DR381102.1,INSD:BP566284.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY085483.1,INSD:AK227978.1"
FT                   /protein_id="AED90331.1"
FT                   /translation="MSFLIPNRGVGGTKIPLSIIVLVLCGFMFFILLYTERISLLSSSS
FT                   SSSSSFFKLKSCPRKDVSSKPKEKIRKERSEILEVLDDRFEFDPEECNVAAGKWVYNSS
FT                   IEPLYTDRSCPYIDRQFSCMKNGQPETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLL
FT                   FVGDSLQRSQWESFVCLVESIIPEGEKSMKRSQKYFVFKAKEYNATIEFYWAPYIVESN
FT                   TDIPVISDPKKRIVKVDSVKDRAKFWEGADILVFNTYVWWMSGLRMKALWGSFGNGESG
FT                   AEALDTQVAYRLGLKTWANWVDSTVDPNKTRVFFTTMSPTHTRSADWGKPNGTKCFNET
FT                   KPIKDKKFWGTGSNKQMMKVVSSVIKHMTTHVTVINITQLSEYRIDAHTSVYTETGGKI
FT                   LTAEQRADPMHHADCIHWCLPGLPDTWNRILLAHL"
     atgagcttct tgattcctaa tagaggagta ggaggaacca agattcctct ctccatcatc        60
     gttctcgttc tttgtggttt catgttcttc attctcttat acactgaaag aatcagcttg       120
     ttgtcttctt cttcctcttc gtcttcatct ttcttcaagc taaagtcttg tccgaggaaa       180
     gatgttagct cgaaacctaa ggagaaaatt cgaaaggaaa gatcagagat attggaagtg       240
     cttgacgaca ggttcgaatt cgatcccgaa gagtgtaacg ttgcagcagg gaaatgggtt       300
     tacaatagct caattgaacc actctacacc gatagatcat gtccatacat cgatcgtcaa       360
     ttctcttgta tgaaaaacgg acagccagaa actgattatc ttcggtggga atggcagcct       420
     gatgactgta caattccacg atttagtccg aagttagcaa tgaacaaact cagaggaaaa       480
     agactacttt ttgtgggaga ttcgttgcaa cgaagccaat gggaatcgtt cgtgtgtttg       540
     gtggaatcaa taatacccga aggagaaaaa tcaatgaagc gtagccaaaa atactttgta       600
     tttaaagcaa aggaatacaa tgcgactata gagttctatt gggcaccgta tatcgtcgaa       660
     tcaaacacag atatacctgt gatttcggat ccaaagaaac ggatagtgaa agtggactca       720
     gtgaaagatc gagctaagtt ttgggaagga gctgatattt tggttttcaa cacttatgtt       780
     tggtggatga gtggtctccg catgaaagct ctgtggggtt ctttcggaaa tggagagagt       840
     ggtgcagagg cactagacac acaagtggct tacaggctag gactcaagac atgggctaat       900
     tgggtagact ccaccgttga ccctaataag accagagtct tcttcaccac catgtctcct       960
     actcatacta gaagtgcgga ttggggaaag ccaaacggca cgaagtgttt caacgagacg      1020
     aaaccgataa aagataagaa gttttgggga acaggctcta acaagcagat gatgaaagta      1080
     gtgtcaagcg tgataaagca catgactacg catgtgacag tcatcaacat cacgcagctc      1140
     tctgagtatc gcatcgacgc tcacacatca gtttacaccg agacaggtgg caagatccta      1200
     accgctgagc agagggctga tccaatgcat cacgctgatt gtatacattg gtgtttacct      1260
     ggactacccg atacatggaa tcggatccta ttggctcatt tgtaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page