(data stored in ACNUC13479 zone)

EMBL: CP002688.TBL35

CP002688.TBL35       Location/Qualifiers
FT   CDS_pept        join(232882..233092,233183..233492,233691..233862,
FT                   233964..234160,234242..234394,234491..234821)
FT                   /codon_start=1
FT                   /gene="TBL35"
FT                   /gene_synonym="F7A7.140"
FT                   /gene_synonym="F7A7_140"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 35"
FT                   /locus_tag="AT5G01620"
FT                   /product="TRICHOME BIREFRINGENCE-LIKE 35"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 35 (TBL35); LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF231, plant
FT                   (InterPro:IPR004253); BEST Arabidopsis thaliana protein
FT                   match is: TRICHOME BIREFRINGENCE-LIKE 34
FT                   (TAIR:AT2G38320.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01620"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01620.3"
FT                   /db_xref="GOA:Q8RXQ1"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RXQ1"
FT                   /protein_id="AED90368.1"
FT                   /translation="MSQRWSRKKSRLPLAGLLFILVVTFMILFNERSIQQIHHHAASHT
FT                   QNLREPSTFDFVKPNVPRINYLGAHGFCFEKNAEVLDRFSKCNSTKEYSGKKIGWVDPF
FT                   EDHPGQVTKEEQKCDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHW
FT                   RWQPHACNLKRWNAIEMWEKLRGKRLMFVGDSLNRGQWISMVCLLQSVIPRDKQSMSPN
FT                   AHLTIFRAEDYNATVEFLWAPLLVESNSDDPVNHRLSERIIRPDSVLKHASKWQHADIL
FT                   IFNTYLWWRQDSVKLRWSSEEKGSCEEVKSAEGMEMAMDSWGDWVANNVDPNKKRVFFV
FT                   TMSPTHQWSREWNPGSEGNCYGEKKPIEEESYWGSGSDIPTMRMVKRVLERLGPKVSVI
FT                   NITQLSEYRKDGHPSVYRKFWEPLNEDRLKNPASYSDCTHWCVPGVPDVWNQLLFHFL"
     atgtcgcaga gatggagtag aaagaagagt agacttccat tagcgggtct cctctttatt        60
     ctcgttgtca cctttatgat tctcttcaac gagcgtagca ttcagcagat ccatcaccac       120
     gccgcgagtc acactcaaaa tctccgagaa ccttccacgt tcgatttcgt caagcctaat       180
     gttcctcgga ttaactactt gggagctcat ggattctgtt ttgaaaaaaa tgcagaggtt       240
     ttggatagat tcagcaaatg caactcgacg aaagagtaca gtgggaagaa aatcggatgg       300
     gttgacccgt ttgaagacca cccgggtcaa gtaacaaagg aggagcagaa atgtgatgtc       360
     ttttctggga aatgggtctt tgataattca tcatcatacc ctttacacaa ggaatctcag       420
     tgtccttaca tgtccgacca gttggcttgt cagaagcatg gtaggaagga tttggagtat       480
     cagcattgga gatggcaacc tcatgcctgc aacttgaaga gatggaatgc gatagaaatg       540
     tgggagaagc tgagaggaaa gagattgatg tttgttggag actcgttaaa cagaggccaa       600
     tggatttcaa tggtttgtct cttacagtct gtcattccac gtgacaagca gtctatgtct       660
     cctaacgctc acctcaccat tttcagggct gaggactaca atgccacagt ggagtttctc       720
     tgggcaccgt tgctcgtgga gtcgaattct gatgaccctg ttaatcacag attgagcgag       780
     cggattatcc gacccgattc tgttcttaaa catgcatcaa agtggcaaca tgctgatatt       840
     ctaatcttca acacctactt atggtggaga caagactctg tcaagctccg atggagcagt       900
     gaagaaaaag ggtcatgcga ggaggtgaag agcgccgagg gaatggagat ggcaatggat       960
     agttggggtg attgggttgc taacaatgtc gatccaaaca aaaagcgagt tttcttcgtt      1020
     acaatgtctc ctacacatca atggagccga gaatggaacc cgggaagcga aggaaactgc      1080
     tacggggaga agaaaccaat agaggaagag agttattggg gaagtgggtc ggacattccg      1140
     acaatgagga tggtgaagag agttttggag agattgggac caaaggtctc agttataaac      1200
     atcactcagt tgtctgagta tcgaaaagat ggtcatccat cggtgtaccg gaaattctgg      1260
     gaacctctaa atgaagaccg gttgaaaaac ccggcatcgt attctgactg tactcattgg      1320
     tgtgtacctg gagttcctga tgtctggaat caattgcttt tccatttttt gtga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page