(data stored in ACNUC13479 zone)

EMBL: CP002688.WRKY62

CP002688.WRKY62      Location/Qualifiers
FT   CDS_pept        complement(join(351136..351661,351748..352013))
FT                   /codon_start=1
FT                   /gene="WRKY62"
FT                   /gene_synonym="ARABIDOPSIS THALIANA WRKY DNA-BINDING
FT                   PROTEIN 62"
FT                   /gene_synonym="ATWRKY62"
FT                   /gene_synonym="T20L15.170"
FT                   /gene_synonym="T20L15_170"
FT                   /gene_synonym="WRKY DNA-binding protein 62"
FT                   /locus_tag="AT5G01900"
FT                   /product="WRKY DNA-binding protein 62"
FT                   /note="WRKY DNA-binding protein 62 (WRKY62); CONTAINS
FT                   InterPro DOMAIN/s: DNA-binding WRKY (InterPro:IPR003657);
FT                   BEST Arabidopsis thaliana protein match is: WRKY
FT                   DNA-binding protein 38 (TAIR:AT5G22570.1); Has 3146 Blast
FT                   hits to 2717 proteins in 131 species: Archae - 0; Bacteria
FT                   - 0; Metazoa - 0; Fungi - 0; Plants - 3132; Viruses - 0;
FT                   Other Eukaryotes - 14 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZV6"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CB185474.1,INSD:CB185507.1,INSD:BE662848.1,
FT                   INSD:CB185477.1,INSD:CB185574.1,INSD:CB185517.1,
FT                   INSD:CB185503.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF224700.1"
FT                   /protein_id="AED90407.1"
FT                   /translation="MNSCQQKAMEKLLHGHGCANQLLIMDQTESDSSMEREDLAKSVLH
FT                   CFSDALSILIDTNDHQDDQSNNSSPQDSSPVLESSRKPLHKRGRKTSMAESSDYHRHES
FT                   STPIYHDGFLWRKYGQKQIKESEYQRSYYKCAYTKDQNCEAKKQVQKIQHNPPLYSTTY
FT                   FGQHICQLHQAYATFPIDTSDFEEHEGSHMIRFGHPNISFSSSTSNLRQHQNHQDRIKD
FT                   EYMKPVIAEDWSPSQWMSSEVALAVEAFEFNPFWTSHDLSS"
     atgaactctt gccaacaaaa ggctatggag aagttgcttc acgggcatgg gtgcgccaac        60
     cagctgctca tcatggacca gaccgagtca gactcgtcca tggaaaggga ggatttggcc       120
     aagtccgtcc tccattgttt ctcagatgcg ctctccatct tgatcgatac taatgaccac       180
     caagacgatc aatccaataa ctcatctcct caggactctt ctcctgtgct tgagagctcc       240
     aggaaaccac ttcacaagag gggaagaaag acatctatgg cagagagctc agactaccat       300
     agacacgaat cttcaacccc gatctaccac gacggcttcc tctggaggaa atacggacaa       360
     aagcagatca aagaatctga gtaccaaagg agttactaca agtgtgccta caccaaggac       420
     cagaactgtg aagcaaagaa gcaggttcaa aagatccaac acaatcctcc attgtactca       480
     accacttact tcggccagca catatgccag cttcatcaag cttatgcaac tttccccatt       540
     gacacatctg acttcgaaga gcacgaggga tcccacatga tccgattcgg tcaccccaac       600
     atcagcttct cctcctccac ctctaacctc cgccaacatc agaatcatca ggatcgcatc       660
     aaagatgaat acatgaaacc ggtgatagca gaagattggt ctccatccca gtggatgtcg       720
     tccgaggttg ccctcgccgt ggaggctttc gagtttaatc ctttctggac atctcacgac       780
     ttatcatcat ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page