(data stored in ACNUC6288 zone)

EMBL: CR382138.PE107

CR382138.PE107       Location/Qualifiers
FT   CDS_pept        211743..212369
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02552g"
FT                   /old_locus_tag="DEHA0F02838g"
FT                   /old_locus_tag="DEHA-IPF8910"
FT                   /old_locus_tag="DEHA-CDS5272.1"
FT                   /product="DEHA2F02552p"
FT                   /note="highly similar to uniprot|Q9UUT7 Yarrowia lipolytica
FT                   nukm Subunit NUKM of protein NADH:Ubiquinone Oxidoreductase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88782"
FT                   /db_xref="GOA:Q6BMU5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMU5"
FT                   /protein_id="CAG88782.1"
FT                   /translation="MYSLARRSILSVGRHQSMKMIPYGAVRSISSKDLTPKPLATDFPL
FT                   MSQKTASAPVDYALTSLDAIANWARKSSFWPVTFGLACCAVEMMHVSTPRYDQDRLGII
FT                   FRASPRQSDIMIVAGTVTNKMAPALRQVYDQMADPRWVISMGSCANGGGYYHYSYSVVR
FT                   GCDRLIPVDVYVPGCPPTAEALMYGVFQLQKKMMKTRITRLWYRS"
     atgtattcat tagctagaag atctatattg agtgtcggca gacatcaatc tatgaagatg        60
     attccatatg gagctgtccg ttcgatttcc tcaaaggatt tgacgccaaa gccattggct       120
     accgacttcc cattgatgtc gcaaaagaca gcttcggctc ctgttgatta cgctttaacc       180
     tcgttggatg ccatcgctaa ctgggctaga aaatcgtcgt tttggcccgt cactttcggt       240
     ttggcttgtt gtgccgtcga aatgatgcat gtttccactc caagatacga tcaagataga       300
     ttggggatta ttttcagagc atcccctcgt caatccgata tcatgattgt cgcaggtacc       360
     gtcacgaaca agatggctcc agctttgaga caagtttacg atcaaatggc cgacccaaga       420
     tgggtcattt ctatgggctc gtgtgccaac ggtggtggtt attaccatta ttcgtactcg       480
     gtcgtcagag gctgtgacag acttatccct gtagatgtct acgttcctgg atgtcctcca       540
     actgccgaag ccttgatgta cggtgttttc caattacaaa agaaaatgat gaagactaga       600
     atcaccagat tatggtacag aagttaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page