(data stored in ACNUC6288 zone)

EMBL: CR382138.PE109

CR382138.PE109       Location/Qualifiers
FT   CDS_pept        complement(213771..216014)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02596g"
FT                   /old_locus_tag="IPF_8907"
FT                   /product="DEHA2F02596p"
FT                   /note="some similarities with uniprot|P32831 Saccharomyces
FT                   cerevisiae YBR212W NGR1 negative growth regulatory protein
FT                   and similar to CA5915|IPF10735 Candida albicans IPF10735"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66259"
FT                   /db_xref="GOA:B5RU82"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU82"
FT                   /protein_id="CAR66259.1"
FT                   /translation="MSFLQSNKGEYVSNNAETGSDTPVGVDSENTGIKPSSVANPSVSS
FT                   NLHGAVAPLEQPALTSSTASHQHQQEQEMLSGFTIPRPPVSTQQSSVAAEKEQGSNTGQ
FT                   PDSPRTLWMGDLDPWLDEGAISDLWWQILHKKVTVKIIKPKTPKPENNAQGLSHSGYCF
FT                   VEFESFDDAQQALGLNGQLLPDIAMPSQQQFPNNPDNQKKYFRLNWASGATLSAPIVQT
FT                   PEYSLFVGDLSASTTEAHLLAFFQKSFPTSIKTVRVMTDPVSGKSRCFGFVRFTDESER
FT                   QRALVEMHGAWFGGRPLRVALATPRNVGGKLRYPNIPSPNFYNPDQGRQMFIPPNAMPM
FT                   GGSPFGFFGNPQMPPPPHHPHQVPPRQSYPSHMSPMDMQPTKEYSDDRDQNVSSNGQPN
FT                   VEQLRSPNLQGGQHGQPFTDPNNTTVFVGGLSSEVTEQTLFTLFKPFGIIQQVKIPPGK
FT                   NCGFIKYSSREEAEEAIAAMQGFIIGGNRVRLSWGRVSMNNKKYQQQQQQVAQAAQMQA
FT                   ATALSMGMDPASAIAAAAAAAAAGGYPPPIPGAHGHSQNAGMPMMGGMPPMGLPPHISM
FT                   QSRGNLRSPNPSNIQNYSTSSEDNDASFDKSDVDSNERPSNESQGRGHGIAPPPFYMGG
FT                   LPTDYHIPPPGSQQGQDELADSMAHMNLNGENHDSNANSENFMAYQGDHRFMMPPMFNG
FT                   GFPMHDLQYQQFIPSQQLDPQAMYPPQDDRAANDDSIDNAKADDNDSKNDNDD"
     atgtcttttt tacaatctaa taaaggtgaa tatgtttcaa ataatgccga aactggtagt        60
     gacacccctg ttggtgttga ttctgaaaat acaggtatca agccgtcttc ggttgctaac       120
     cctagtgttc tgtccaactt gcatggtgct gtcgcaccat tagaacagcc tgcattaaca       180
     tcaagtactg ctagccatca gcaccaacaa gaacaagaaa tgctatcagg ttttactata       240
     cctaggccgc ctgtgtctac gcaacaatcg agtgtagcag ctgaaaaaga gcaagggtcc       300
     aatacaggtc agcctgattc tccacgtaca ttatggatgg gtgacttaga cccgtggcta       360
     gatgaaggtg ctatatctga tttatggtgg cagatattgc ataaaaaggt aactgttaag       420
     attataaagc ctaaaacccc taaaccagag aataatgcac aaggactctc acattctggt       480
     tattgttttg ttgaatttga aagttttgat gatgctcaac aagcattggg tttaaatggc       540
     caattattac cagatatagc tatgccatcg caacagcaat ttccgaataa cccagataat       600
     cagaagaaat atttcagact taattgggct agtggtgcaa cgttgagtgc tcctatcgtt       660
     cagactcctg aatattcatt atttgttgga gatttatcgg cgtccacaac tgaagcacat       720
     ttattggcat ttttccagaa aagtttccca acatcgatta aaacagtacg ggttatgaca       780
     gaccctgttt ctggcaaatc aagatgcttt gggttcgtta gattcacgga tgaactggaa       840
     agacagcggg cgttggtaga aatgcatggt gcttggtttg gtgggagacc attgagggtt       900
     gccttagcga ctccaaggaa tgtaggagga aagcttcgat accctaatat tccaagtcct       960
     aatttctata atcctgacca gggaagacaa atgtttattc cacccaatgc tatgccaatg      1020
     ggtggttctc catttggatt ttttggaaat ccacaaatgc cacctccacc acaccatcct      1080
     catcaggtac ctccacggca atcatatcca agtcatatgt ctcctatgga tatgcaacct      1140
     accaaagaat atagtgacga ccgtgatcag aatgtttcgt caaatggcca gcctaacgtt      1200
     gagcagctta ggtccccgaa tttacagggc ggtcaacacg gtcagccatt tactgaccct      1260
     aataatacta cagtatttgt cggaggttta tcatctgaag ttaccgaaca aactttattt      1320
     acgctcttta aaccgtttgg tataattcaa caagtgaaaa tcccaccagg aaagaattgt      1380
     ggtttcatta aatattcctc ccgtgaagaa gctgaagaag caattgctgc tatgcaaggg      1440
     tttattattg gaggtaatag agttagatta agttggggca gagtttcgat gaataataag      1500
     aaataccaac agcaacaaca acaagtagcc caggctgctc aaatgcaagc tgcaactgca      1560
     ttatctatgg gaatggaccc agctagtgca attgctgccg ctgccgctgc ggcagccgct      1620
     ggtggatatc ctccgccgat acctggagca catgggcatt cgcaaaatgc tggtatgcca      1680
     atgatgggag gaatgccacc aatgggcctt cctccacata tttctatgca atcgcgtggt      1740
     aatttgcgtt ctcctaatcc ttcgaacatt cagaattact ctacatcaag tgaagataat      1800
     gatgcttcat tcgataaatc tgacgttgat tcaaatgaaa gaccttctaa tgaaagccaa      1860
     ggtagagggc atggaattgc gccaccccca ttctacatgg gtggcctacc tacagattat      1920
     cacattccac ctcctggttc ccaacaagga caagatgaat tggctgattc aatggctcat      1980
     atgaatttga atggtgagaa tcatgattcc aatgccaatt cagaaaactt catggcctac      2040
     caaggagacc acaggtttat gatgcctcca atgttcaatg gaggatttcc aatgcatgat      2100
     cttcagtacc aacaatttat accactgcag cagcttgacc ctcaagctat gtacccacct      2160
     caagatgatc gagcagctaa tgacgatagt atagataatg ctaaggcaga tgataatgat      2220
     agtaaaaatg ataatgatga ttga                                             2244
//

If you have problems or comments...

PBIL Back to PBIL home page