(data stored in ACNUC6288 zone)

EMBL: CR382138.PE110

CR382138.PE110       Location/Qualifiers
FT   CDS_pept        221708..222040
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02618g"
FT                   /old_locus_tag="DEHA0F02937g"
FT                   /old_locus_tag="DEHA-IPF8900"
FT                   /old_locus_tag="DEHA-CDS7040.1"
FT                   /product="DEHA2F02618p"
FT                   /note="highly similar to uniprot|P53173 Saccharomyces
FT                   cerevisiae YGL054C ERV14 Protein localized to COPII-coated
FT                   vesicles involved in vesicle formation and incorporation of
FT                   specific secretory cargo"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88787"
FT                   /db_xref="GOA:Q6BMU1"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMU1"
FT                   /protein_id="CAG88787.1"
FT                   /translation="MYSDLECDYINPIELCNKLNPWFIPEGGLHAFITALFLVNGYWFV
FT                   FLLNLPLLAFNVNKFLNKNHLLDATEIFRTLSKHKKESFIKLGFHLLMFFFFLYRMIMA
FT                   LIADDS"
     atgtattcgg atttagaatg tgattatatt aatccaattg aattatgtaa caaattaaat        60
     ccatggttta tcccagaagg tggtttacat gctttcatta ctgcattatt cttggttaat       120
     ggatactggt ttgtcttttt attgaatttg ccattacttg catttaacgt caacaaattt       180
     ttaaataaga atcacttgtt ggatgcgaca gaaattttca gaactttatc taaacataag       240
     aaggaatcat ttatcaagtt aggtttccat ttattgatgt tcttcttctt cttgtacaga       300
     atgattatgg ctttaattgc tgatgatagc taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page