(data stored in ACNUC6288 zone)

EMBL: CR382138.PE113

CR382138.PE113       Location/Qualifiers
FT   CDS_pept        complement(225048..226931)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02684g"
FT                   /old_locus_tag="DEHA0F03025g"
FT                   /old_locus_tag="DEHA-IPF8894"
FT                   /old_locus_tag="DEHA-CDS1482.1"
FT                   /product="DEHA2F02684p"
FT                   /note="similar to uniprot|P32864 Saccharomyces cerevisiae
FT                   YOR370C MRS6 Rab escort protein forms a complex with the
FT                   Ras-like small GTPase Ypt1p that is required for the
FT                   prenylation of Ypt1p by protein geranylgeranyltransferase
FT                   type II (Bet2p-Bet4p) and highly similar to CA5922|CaMRS6
FT                   Candida albicans CaMRS6 geranylgeranyltransferase
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88791"
FT                   /db_xref="GOA:Q6BMT7"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT7"
FT                   /protein_id="CAG88791.2"
FT                   /translation="MSSFNRSERRKSVAERRPSVPYIAPVIPHLAGLEKPQEHSLKMDH
FT                   CDVLIMGTGLVESILAAALSWQGVEILHIDNKQYYGDSTSTLTIDQLKKWCMEVNQGKV
FT                   QHFHDAQFYMPGGKLKDQFHSKDYGIDLTPKIMFAQSDLLSLLIKSRVYKYLEFQSLSN
FT                   FHVFENDNFNKKLSNTTKEDIFTDQSLSLVTKRYLMKFLKFVLQDNNDQNKKSMLQDNA
FT                   NVPIGEFLTKNFNLETPQINELVYSIGLCAKTTTKTPEALTRIKRFLVSFDVYGNFPVM
FT                   VSKYGGPGEISQGFCRSAAVAGTTYKLNTTLVDYDPQSKIARFNDGSNIKINEKVVVSP
FT                   TQMPKFLQQSYNEITEDLKPYNVTRLVTIVKNDCKEWMSEQETSAIVVFPPNSLPTSNQ
FT                   QSVQVIIQNGGSGVCPEGQAVWFSHSSEQDLNKAKQDLECAHEKMESAILRESSNNLDE
FT                   VLDDKDFVLSAQGTPVLVNSIKLGESLQSFVPEEKLEIVCKLGYVQKTFVKPDLSNVIA
FT                   PTPENNVSSATISDAEDIIFSNMPSSEISYDGIIGECKSIFSRITGSDEDFFDVDFEDE
FT                   DDDYNNHQAPSTNSKTTSDSTTTNNIGSPILDSVLDDEGHHEPFGADEMEL"
     atgagttcgt tcaatagatc ggaaagaaga aaatctgtgg cggaaagaag acctagcgtg        60
     ccatatattg caccggtcat tccacacttg gctggtttag agaaaccaca agagcatagc       120
     ttgaaaatgg accactgtga cgtgttgatt atgggtactg gattggtcga gagcatattg       180
     gcggctgcgt tatcgtggca aggcgttgaa atattgcata tcgataataa gcagtactat       240
     ggtgatctga cttcgacgtt gacgatagac caattgaaaa aatggtgtat ggaagtcaat       300
     caaggcaagg tacaacattt ccatgatgca caattctata tgcctggggg aaaactcaaa       360
     gatcaatttc acagcaaaga ttatggtatt gacttgactc ctaagatcat gtttgctcaa       420
     tcagacttgt tgtccctttt aattaagtct cgtgtttata agtacttgga attccaaagt       480
     ttaagcaact tccatgtttt cgaaaacgat aactttaata agaaactctc aaacactacg       540
     aaagaggata tcttcacgga tcaatcgtta tcgttggtga ctaagaggta tcttatgaaa       600
     tttttgaaat ttgttttaca agataataat gatcagaaca agaagagtat gctacaggat       660
     aatgctaacg ttccaatcgg cgagttttta actaaaaatt ttaaccttga aacgccccaa       720
     attaacgaat tggtttattc gattggttta tgcgctaaga caacaacgaa aacaccagag       780
     gcgttaacta gaataaagag atttttggtc tcatttgatg tttatggtaa ctttccggtg       840
     atggtcctga aatatggtgg tcccggtgaa atttcacaag gattttgtcg tagcgctgca       900
     gttgccggta caacttacaa gctaaacact actttagttg attatgatcc acaactgaag       960
     attgcaaggt tcaatgacgg cagtaatatc aaaatcaacg aaaaagttgt tgtatcacct      1020
     actcaaatgc caaagttttt gcagcaaagt tataatgaaa taacggaaga cttaaaacct      1080
     tataacgtga ctagattagt gacaattgtg aaaaacgatt gtaaagaatg gatgtcagaa      1140
     caagaaacat ctgccattgt ggtattccca ccaaactctt taccaactag taaccagcaa      1200
     agtgttcaag ttataataca aaatgggggt tctggtgtat gtcccgaggg acaagcagtt      1260
     tggttctcac atagtagtga gcaagacttg aataaagcaa agcaagactt ggaatgtgca      1320
     catgaaaaga tggagtcagc tatattgcgt gaatcgtcca ataatttaga tgaagtttta      1380
     gatgataaag attttgtttt gagtgcccaa ggtaccccag tgttggttaa ctcgatcaaa      1440
     ttaggcgaat cgttacaaag ctttgttcct gaagagaaat tagaaattgt ttgcaagctc      1500
     gggtatgttc aaaagacttt tgtaaagcct gacttatcaa atgttatagc gccaacacca      1560
     gagaataatg tatcttctgc taccattagc gacgccgaag atattatttt ctcaaatatg      1620
     ccatcgtccg aaattagtta cgatggtata attggtgaat gcaaactgat tttctctaga      1680
     attacaggat ctgacgagga ttttttcgat gttgattttg aagacgagga cgatgattac      1740
     aacaaccacc aagcacctag caccaattcc aaaactactt cagattctac cactaccaac      1800
     aatattggct cgcctatatt ggacagtgtg cttgatgacg aaggacatca tgaaccattc      1860
     ggtgctgacg aaatggaatt ataa                                             1884
//

If you have problems or comments...

PBIL Back to PBIL home page