(data stored in ACNUC6288 zone)

EMBL: CR382138.PE120

CR382138.PE120       Location/Qualifiers
FT   CDS_pept        247638..249560
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02838g"
FT                   /old_locus_tag="DEHA0F03234g"
FT                   /old_locus_tag="DEHA-IPF8870"
FT                   /old_locus_tag="DEHA-CDS1412.1"
FT                   /product="DEHA2F02838p"
FT                   /note="weakly similar to uniprot|P38738 Saccharomyces
FT                   cerevisiae YHL029C Cytoplasmic protein required for
FT                   replication of Brome mosaic virus in S. cerevisiae which is
FT                   a model system for studying replication of positive- strand
FT                   RNA viruses in their natural hosts and similar to
FT                   CA5934|IPF2802 Candida albicans IPF2802 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88802"
FT                   /db_xref="GOA:Q6BMT2"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMT2"
FT                   /protein_id="CAG88802.2"
FT                   /translation="MSQDFINTDNHTSNLSSNNLYTNINAGNSIMSEELAVKDNSNSTV
FT                   ASDNTERTPCDAENGSIYTTGRSVVSDNAGNQDKGKNFPNGESSSASGKSENSHADDEN
FT                   DGSTENNSKLGQPSFSYDSEIFQLCQHYLTTKNHQGLALVARQKGLPPFLRFKIWPILL
FT                   KHHPFVVNPFIEPDNEVNNENDTNTEEDLKSDIKRDLLKYIHRLNYTNLIDLNNASPEE
FT                   QEVFKILESSILKFVKKWGKIMKYDHALTWIALGLAEWFPPIPNTSWVLVGRDFPSSKT
FT                   SCIKNLFHDYSNYINNVPNLNEYLEDLVNDKEIINMSFRDVYERLVLVLLHAPEEKIKN
FT                   KSKDLLGPKKINRKILPINGGTIEERVSFFIYCFRKLLPELSQYFQEEQILNKFGSHDD
FT                   EWLIWWLKWCGSKVWSRLDRGRIWDLIFGWRLQNFKKSNSYYVEKLNLSDNLINKLGPD
FT                   NFWSVSKDNDDSTIENYKKSSSFKDLINELNINESSNSNSPTSNSPSNSSINEDLLPPS
FT                   PLSSSSFSSSNIAPADEFNIPFSKLDPHVELLFVTLALLKSKENTLMELDQHEIRQFLS
FT                   RLPTKSINISNKYKHFKPQESDMNNNIISNDSRNNHKIDFMDNIINESGELWRKWLWSE
FT                   MIDDN"
     atgtcccaag atttcattaa tactgataat catacgtcta atttaagttc gaataactta        60
     tatacaaata taaacgccgg taatagcatc atgtctgaag aattagctgt caaagataat       120
     agtaattcta ccgtggcgtc cgataatacg gaaagaacac cttgtgacgc agaaaatggt       180
     ctgatatata ctacaggaag aagtgtagtt tcggataatg ctggcaatca ggacaaaggt       240
     aaaaatttcc ctaatggcga aagctcttcg gccagtggta agtcggaaaa cagccatgca       300
     gatgacgaga acgatggtag cacagaaaac aattccaagc ttggacagcc atcatttagt       360
     tatgattctg aaatttttca actctgtcaa cattatctta ccacgaaaaa tcatcaaggt       420
     ttagcattgg ttgcgagaca aaaaggttta cctccatttt tgagatttaa gatttggcct       480
     atactattga agcaccatcc attcgttgtg aatccattta tcgaaccaga taatgaagtt       540
     aataatgaaa atgatacgaa tactgaagaa gatctcaaac tggatataaa gagggattta       600
     ttaaaataca tacatcgttt gaactacaca aacttaattg atttgaataa tgcatcacca       660
     gaagaacaag aagtctttaa gattttggaa tcttcaatct tgaaattcgt taaaaagtgg       720
     ggcaagataa tgaaatatga tcatgcttta acgtggattg ctttgggcct tgccgaatgg       780
     tttcctccta tccctaatac atcatgggtt ttggttggta gagattttcc ttcgtccaaa       840
     acctcatgca ttaaaaacct ttttcatgat tattccaatt atattaataa tgttccaaac       900
     ctcaatgaat accttgagga tttagtcaat gataaagaaa ttattaacat gtcattccgc       960
     gacgtatatg aacggttagt tttagtacta ttgcatgcac cagaagaaaa gattaagaac      1020
     aaatctaaag atttattggg cccaaagaaa attaatagaa agatcttgcc gattaatggt      1080
     ggtactatag aagaaagagt ttcatttttt atttactgct ttagaaagtt attacctgag      1140
     ttatcccagt atttccaaga agaacaaatt ttaaataaat ttggtagtca tgatgatgaa      1200
     tggctaatct ggtggttaaa gtggtgtggc tcgaaagtgt ggtcaaggtt agaccgaggc      1260
     agaatctggg atttaatttt tggttggaga ttacaaaatt ttaagaaatc caattcatat      1320
     tatgtagaga aattaaattt gagtgataac ttaattaata agttgggtcc cgataacttt      1380
     tggtctgtga gtaaagataa tgacgacctg acgatagaaa attataaaaa atccagctcg      1440
     tttaaagatt tgattaatga attgaatatt aatgaatctt caaattcaaa ttctcctact      1500
     tcgaattcgc cgctgaattc atcaatcaat gaagatctac ttccaccact gccattatct      1560
     tcatcttcat tttcatcgtc aaatattgca ccggctgatg aatttaatat accgttctca      1620
     aaattggatc cccatgttga attattattt gtcacattgg ccttgttaaa atctaaagaa      1680
     aatacgttga tggaattaga tcaacatgaa attagacaat tcttgtcaag gttacctacg      1740
     aaatccataa atataagtaa taagtataag catttcaagc ctcaagaatc agatatgaat      1800
     aataatatta tatcaaatga ctcgaggaac aatcataaaa ttgacttcat ggataatatt      1860
     attaacgaat ccggggaatt gtggagaaaa tggttatggc tggaaatgat agatgacaat      1920
     taa                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page