(data stored in ACNUC6288 zone)

EMBL: CR382138.PE123

CR382138.PE123       Location/Qualifiers
FT   CDS_pept        255711..260384
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02904g"
FT                   /old_locus_tag="DEHA0F03300g"
FT                   /old_locus_tag="DEHA-IPF8861"
FT                   /old_locus_tag="DEHA-CDS0095.1"
FT                   /product="DEHA2F02904p"
FT                   /note="weakly similar to uniprot|P53094 Saccharomyces
FT                   cerevisiae YGL197W MDS3 Protein with an N-terminal kelch-
FT                   like domain putative negative regulator of early meiotic
FT                   gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88805"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS9"
FT                   /protein_id="CAG88805.2"
FT                   /translation="MSTLVPSASSCYGLRLPPTEKDDRLNLNVRTGSASTLYKSLVFTY
FT                   GGLTIGLDIGDESVDELIRIFHSKISNLKSNSIDKYLSGEFFYLDLIEKYWTRVDIPSG
FT                   ERKPKPRVFHEITAVNNCIYVFGGLIVNEKYDSHTHEDTNERELVPCNDLWEFSLESRK
FT                   WNLLHDGSKYEYDAAVPRPRFSHKMTTLSSLSFANRKDHFGIFIAGGRDDESRPLYDNF
FT                   VFDLVTKEYVGSSPIELTLDTKKNSQKFRNVNSIVTSEDYKISVDYVNNVIISFIKEPT
FT                   HHHHHSRTRSTNKAISSDYTSTMEGDESLIVYSQVDSSKDQSINTLLSFKVGKSIKEGK
FT                   ILPVHNKVSTKENETKRITNHTIPYNLKFPTGGLFGQNIVITGFLPNDNDICVFIYNKP
FT                   TGKWSRLNFFCDHDYGSHRCWGGFAWQSHHKVVLLGNYLTSRTTSSIRYFTLMITVSLP
FT                   ITNILASLELEGGHYHCPDGTKVFYKDDNSSTDDNNRDRISEEDAYSSSDALSDGEKKM
FT                   LKRHHSVSASSDKAPQSISFSEYVHYVAPKTKFTTIRSVFPPAAITLGRNAMDRYGDLI
FT                   SDFELVSSKGDRIPVSLRILMERWGRYFVQLLAKGYVQAVDRFERDQQLDSESTRNASS
FT                   ASESMNSANKTQNKLRSSMSTCGGSSISSSNSEVSINQSKPSKKGHHQSSYHVSIPAPS
FT                   KYSKEPPQFRLPFQESSLTNNSVSEKANETINQHFEETKRGIETNNNEKLPDLPGSSHI
FT                   KDEQPDTSRKGSVSSFSSSNSLLNSHLQNIPPQLPLPNEPIPAVPASTSFRGSSRKNSA
FT                   DLNSPRASLMYTLTALRNIPATKSPRESPFSSPRASVSGGPAPMGNELSSLAIPNLKQS
FT                   SLSTDRNNHRLTRSLDSSPNGSTDALPIKTAAGECITDQNFRNKKVSNSSSMASSETFN
FT                   SDKKFSPLSSIQPNTNKIYAKDADDRQDYEETNTTEANNSLFSNPLLDFENAESGKFRM
FT                   EPSLIPRKLYMPFATSSIKAFCEYLYTGQVGNKWLLSPVTLDNLAISKFLDVPLLYDLI
FT                   SEVLFGVIGRKESFIIREGNKLKRRYHELLELTGSVKESGFKFPLDEYEGFMDTIDDGF
FT                   LDITLLKKSSASHKDSSASAMSSKRNKSSLNSASSFRYSISIDDINENAMSLREVPIDE
FT                   TLRSTNTESNQENIPTNNQEESTDDSIEKSTSNSEEDTDFELGYLDARDNSSLNVGPRA
FT                   KSIFDKSGTDMQFHSALDNDQKEKESEMEKSKSLNLTLEQLVSPQSPLPSDYTIDLIYE
FT                   TATLCRDIKLMLRAANVKNMGDVFNQSKLELNIAIEELENKYDEQQKQQDEEQKIEHPQ
FT                   FKGKIPSQPSGNESDTGLEHIRSNMSSSSLSTLGLRSVDLEKTKSNTGFRAIGGFGPFK
FT                   SKTDLKASKMTSFENNKELDRRITRSIKNDEKLKSKTAKDEKLKRLQDQKLERRQTDKP
FT                   KLMTRKSIFTKYKDEGSTSTLASEASTNKKKHGFLHHLSHKKKNEAPINQGDNSSLESS
FT                   NLSRTLSASGSISSANSKKSQGSRIKNSLFGKKRLSN"
     atgtctacgt tagtaccttc ggcaagcagc tgttatggat tacgattgcc accaacagaa        60
     aaggatgatc gactcaattt gaatgtgagg accggctcag catccactct ttataaatca       120
     ttggtattta cgtacggagg gctcactata ggattggata ttggggatga gagtgtggac       180
     gagctaattc ggattttcca tctgaaaata tcgaatttga aatctaatct gatcgacaaa       240
     tatctatcgg gagagttttt ttatcttgat ttgatcgaaa agtattggac acgggtggat       300
     ataccgagcg gtgaacgaaa gcctaaacct agggtatttc atgagataac ggcggttaac       360
     aactgtattt atgtatttgg agggttgatt gtgaatgaga aatatgatag ccacacacac       420
     gaagatacta atgaaagaga attggtgcca tgtaacgatt tatgggagtt tagccttgag       480
     tctcgaaaat ggaatttgct tcatgatggt agcaagtatg aatatgatgc ggctgttcct       540
     agaccgaggt ttagtcacaa gatgacgact ttgagcagct tgtcatttgc taacaggaaa       600
     gatcattttg gtatatttat agcaggtgga agagatgacg aatcaaggcc gttgtatgac       660
     aattttgtgt ttgatcttgt gacaaaggaa tacgtggggt catcacctat tgaactaaca       720
     ctcgacacca agaaaaacag tcaaaaattt cgaaatgtca atagcatagt tacttcagag       780
     gactataaaa ttagtgtcga ttatgttaat aatgtgataa ttagtttcat taaggaaccc       840
     actcaccatc atcatcattc tcgtaccaga tcaacaaata aagctatact gagcgattat       900
     acaagtacta tggaaggtga tgaatcactt atagtgtatt cgcaagttga ttcatcgaaa       960
     gaccagtcaa taaacacatt gctatcgttt aaagttggaa agtccataaa agaaggtaaa      1020
     atattaccag tacataacaa ggttctgaca aaagaaaacg agacgaagag gataacgaac      1080
     cataccattc cttacaactt gaaatttcct acgggtggat tgtttggtca aaatatcgtc      1140
     attacaggat tcttacccaa tgataatgat atatgtgttt tcatttacaa taaaccaaca      1200
     ggtaaatggt ctagactaaa ttttttttgt gatcatgatt atggctcgca tagatgttgg      1260
     ggagggtttg catggcaatc acatcataag gttgtcttac tcggtaatta cctaacatct      1320
     cggactacaa gtagcattag gtattttact ttaatgatca cagtgagctt gccaattaca      1380
     aatatcttag caagtttgga attagaggga ggccattatc attgccctga tggcacaaaa      1440
     gtgttctata aggacgataa ttcttccact gacgataata atagggatag gattagcgaa      1500
     gaagatgctt attcatcatc cgatgcatta agtgatggtg aaaagaagat gcttaaaaga      1560
     catcatagcg tctctgcttc cagtgataag gctcctcaat caataagctt tagtgaatat      1620
     gttcattacg tagccccaaa aacaaagttc accactatta gatcagtctt cccgccagcg      1680
     gctataacct tgggtagaaa tgccatggat agatatggtg atttgatatc tgactttgaa      1740
     ttggtttcat ctaaaggtga taggataccg gtatccttga ggattttaat ggaacggtgg      1800
     ggtagatatt ttgttcagct attagcaaaa ggatatgtcc aggctgtgga taggtttgaa      1860
     cgtgatcaac agttagactc tgagtctaca aggaatgcat cttcagcatc agaaagtatg      1920
     aattctgcaa acaaaactca aaacaagtta agatcgtcga tgagtacatg tggcggttct      1980
     tcgatttcat ccagcaattc tgaagttagt attaaccaaa gtaaaccaag taaaaaggga      2040
     caccatcaat cgtcgtatca cgtttctatc cctgcgccat ctaagtattc taaggagcct      2100
     ccacagttca gactaccctt ccaggagctg tcgctcacga ataattcagt ttcagagaaa      2160
     gcaaatgaaa cgattaacca acatttcgaa gaaacaaagc gtggaataga aacgaataat      2220
     aacgaaaaat tgcctgattt gcctggctcg tcgcatataa aggatgagca acctgacact      2280
     tcccgtaaag gatcagtcag ttcattctca agctctaatt ccttattaaa ttcccatctc      2340
     cagaacattc cacctcaatt accattacct aatgagccaa ttccagcagt tcctgcttca      2400
     acatcattta gaggttcgtc aagaaaaaat tcagcagatt taaattcacc cagagcatca      2460
     cttatgtata ctttgacagc cttgaggaat atacctgcta caaaatctcc cagggagtcg      2520
     ccattttctt ctccgcgagc atcagtgtct ggaggccctg caccaatggg aaacgaatta      2580
     ctgagtctag caattccaaa cttgaaacaa agctctcttt ctactgacag aaataatcat      2640
     cgtctcacaa gatcgctaga cagttcacca aatggttcta ccgacgctct tccgattaag      2700
     acggctgccg gggaatgtat aacagatcaa aattttagaa ataagaaagt ctcgaatagt      2760
     tcttcaatgg catcactgga aacatttaat ctggataaga aattttctcc gttatcatca      2820
     atccaaccaa acaccaataa aatatatgcg aaggatgcag atgaccgtca agattatgaa      2880
     gaaacgaata ctactgaagc aaataattct ctttttagta acccattatt agattttgaa      2940
     aatgcggaga gtgggaaatt cagaatggag ccgtcgctca tcccaagaaa gctttatatg      3000
     ccatttgcaa ctagttcaat caaagcattc tgcgaatatt tatataccgg ccaagttggt      3060
     aacaaatggc ttttatcgcc agtcacattg gataatttgg caatctcaaa atttttggat      3120
     gttccgttat tatatgattt aataagcgaa gttttgtttg gtgttattgg taggaaggaa      3180
     tcatttatta ttagagaagg taataagttg aaaagaagat atcacgaatt attagagtta      3240
     acaggttcgg ttaaggaatc ggggtttaag ttccctttag acgagtacga aggttttatg      3300
     gatactattg atgatgggtt tttagatatc acattactaa agaagtcatc agctagtcat      3360
     aaggatagtt cagcatcggc aatgagtagc aagaggaata agctgtcttt aaattcagcg      3420
     tcatcatttc gttattccat aagtattgat gatattaatg agaatgcaat gtcgctaagg      3480
     gaagtaccaa tcgatgagac gttgagatca acaaataccg aaagtaacca agagaatatt      3540
     ccaactaaca atcaagagga atcaaccgac gattctattg aaaaatctac ttctaatagc      3600
     gaagaggata cggacttcga acttggctat ttagatgcta gagataatct gtcattaaac      3660
     gttggccctc gagcaaaatc gatcttcgat aaatctggga cagacatgca atttcatagt      3720
     gcccttgata acgatcaaaa ggaaaaggaa agcgaaatgg aaaagtctaa aagcttgaat      3780
     cttacgctcg agcagttagt aagtccacag tcgccattac catctgatta tacgatcgac      3840
     ttgatatatg aaactgccac actttgtaga gatataaagt tgatgctaag agcagcaaac      3900
     gtgaagaata tgggtgacgt atttaatcag agtaagcttg aattgaatat agccatagaa      3960
     gaattagaga ataagtacga tgaacaacaa aaacaacaag atgaagagca gaaaattgaa      4020
     cacccacaat tcaaaggaaa gataccatct cagccttctg gaaatgaatc tgatactggt      4080
     ttggagcata ttagatctaa catgtcgtct tcatcattaa gcacgttagg gcttagaagc      4140
     gttgatttgg aaaaaacgaa atcaaataca ggttttaggg ccatcggagg gtttggccca      4200
     tttaagagta aaactgactt aaaggcactg aagatgacct cattcgaaaa caacaaggaa      4260
     ttagatagaa gaattactag gctgattaag aacgatgaaa aattaaaact gaagactgct      4320
     aaggatgaga agttgaagcg actccaagat caaaaattgg aaagaagaca gacagacaag      4380
     ccaaaattaa tgacaagaaa gagtatattt acaaagtata aagatgaggg atcaaccagc      4440
     acattagctt cagaggcgtc gacgaacaag aagaagcatg gctttttgca ccatcttagt      4500
     cacaagaaga aaaacgaagc tcctataaac caaggggata attctctgtt ggaatcttcg      4560
     aatttgagta gaacgttatc tgcatcaggc agtataagtt cagctaatag caaaaagtcg      4620
     cagggactga ggattaaaaa tagcttattt ggcaagaaaa gactttccaa ctaa            4674
//

If you have problems or comments...

PBIL Back to PBIL home page