(data stored in ACNUC6288 zone)

EMBL: CR382138.PE128

CR382138.PE128       Location/Qualifiers
FT   CDS_pept        complement(265464..266492)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03014g"
FT                   /product="DEHA2F03014p"
FT                   /note="similar to uniprot|P23642 Saccharomyces cerevisiae
FT                   YML115C VAN1 Mannosyltransferase with a role in protein N-
FT                   glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66261"
FT                   /db_xref="GOA:B5RU84"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU84"
FT                   /protein_id="CAR66261.1"
FT                   /translation="MPLRNAESVLPMAFHNLMNLTYDHSLIDIAFLVSDCSPDDRTLET
FT                   VFEYSVALQNGTLLNKLQLGERQRHANVIKGSSDLYQLYMDPDYMNNIKKSYNPETFHE
FT                   NYHKPFRSISIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTSNALKSYHSWV
FT                   YWRDVDIETCPGSVIQDLMKHDYDVMVPNVWRPLPTFLGNEQPYDLNSWVESEAAVELA
FT                   KSLDEEDVIVEGYAEYPTWRVHLAYIRDPNGDPNEIIDIDGVGGVSILARARIFRQGVH
FT                   FPAFTFLNHAETEAFGKMAKSMGFRVGGLPHYTIWHIYEPSEDDLREIAKMERKKRRQK
FT                   GK"
     atgcctttaa gaaatgcaga aagcgtactt cctatggcgt tccataactt aatgaatttg        60
     acatatgatc attcattaat tgatatagca ttcttggttt ccgattgttc tccagatgat       120
     cgtactttgg agaccgtttt tgaatattct gtggctttgc aaaatggtac tttattaaac       180
     aaactacaac tcggtgaacg tcagagacac gcgaatgtaa ttaaaggatc atctgatttg       240
     taccaattat acatggatcc agattatatg aataatatta aaaagtccta taatcccgaa       300
     acattccacg aaaattatca taagccgttc agatcaatat ccattttcag gaaagatttt       360
     ggtcaagtaa taggacaggg tttcagtgat agacatgctg taaaagttca aggaattcgt       420
     aggaaattga tggggagggc cagaaattgg ttgacttcta atgcattgaa atcataccac       480
     tcatgggttt actggagaga cgtagatatt gaaacttgcc cgggttcagt tattcaagat       540
     ttaatgaaac atgactacga tgtgatggtg ccaaatgttt ggaggccatt accaacattc       600
     ctaggtaatg aacagccgta tgatttgaat tcctgggttg aatctgaagc tgcggtagaa       660
     ttggcaaaat ccttagatga agaagatgtt attgtggaag gttatgctga atacccaact       720
     tggcgagtac atctagcgta tattagagat ccaaatgggg atccaaatga aataattgac       780
     attgacggtg tgggtggtgt ttctatatta gcaagagctc gaattttcag gcagggtgtt       840
     catttcccag catttacatt tttaaaccat gctgaaaccg aggcgtttgg taaaatggcc       900
     aaatctatgg gattcagagt tggtggttta ccacactata ctatttggca tatttatgaa       960
     cctagtgaag acgacttgcg agaaattgct aaaatggaga ggaagaagag gagacaaaaa      1020
     ggtaaatga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page