(data stored in ACNUC6288 zone)

EMBL: CR382138.PE131

CR382138.PE131       Location/Qualifiers
FT   CDS_pept        complement(271020..272102)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03080g"
FT                   /old_locus_tag="DEHA0F03476g"
FT                   /old_locus_tag="DEHA-IPF8848"
FT                   /old_locus_tag="DEHA-CDS4106.1"
FT                   /product="DEHA2F03080p"
FT                   /note="weakly similar to uniprot|Q06991 Saccharomyces
FT                   cerevisiae YLR414C Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88813"
FT                   /db_xref="GOA:Q6BMS1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS1"
FT                   /protein_id="CAG88813.1"
FT                   /translation="MFRIVRLIIILLSIATTVLSIFALVGSYKNEAYLTKIYLLDFHLT
FT                   DLDVSQLIDFNGFSKRDTIHPDSKRDTILPGRTVVEKDLASSLSDIGSTISGIVNSITY
FT                   EDMGLAQVYSISLWGYCKGEVKGSSKTEKGFDNSDIDFKWCSDPKPAYFFDPLEIIKQE
FT                   LNNTINDKITGASGSIDISSDVRTVLEQIVDNITYETLNLPGNLNKQLTLLNNLTKAAF
FT                   ALILIMAILSAIGVFVQLIGCCVDPSNCCLSCINFLFQTLVFLTGIIGAGLATGAYIYV
FT                   RKQINENTGELGIKSFLSIAFYALIWSAVAAALLVLIFTIIGHCCGCLSNNRKKYKPLD
FT                   APAVPEKNGYEMGYNHHQNY"
     atgtttagaa tcgtcagatt aataatcatc ttgctttcga tagcgaccac agtattatcg        60
     atatttgcat tagttggatc atacaaaaat gaagcctact tgaccaaaat atatttgtta       120
     gatttccatc ttactgattt agatgtgtcg cagcttatag atttcaatgg attctccaag       180
     agagatacta tacatcctga tagtaagaga gatactattt tacctggtcg tacggtggtg       240
     gaaaaggacc ttgccagtag tttatcagat attggatcga ctatcagcgg catcgttaat       300
     tcaataactt acgaagatat ggggttggcg caggtatact cgatcagttt gtggggttac       360
     tgtaagggag aagttaaggg cagttcaaaa acagaaaagg gcttcgataa ctcggatatc       420
     gattttaagt ggtgctccga tcctaagcca gcatatttct tcgacccgct agaaattatc       480
     aaacaagaat tgaacaatac tataaatgat aagattacag gcgcatcggg tagtattgac       540
     atttcgtctg atgtgagaac ggtattggaa caaatagttg ataatattac atatgagact       600
     ttaaatttgc ctggtaactt aaacaagcaa cttacgcttt taaacaactt gactaaggcc       660
     gcgttcgcat tgatattgat catggctatt ttgtcagcta ttggtgtatt cgttcaactt       720
     attggatgtt gtgtggaccc aagtaattgt tgtctttcat gtatcaactt cctctttcaa       780
     acattggttt tcctcactgg tattattgga gcagggttag caactggtgc ttatatctat       840
     gtgagaaaac aaattaatga aaataccgga gagcttggta ttaagtcttt cttatcgatt       900
     gcattttatg cattgatatg gtctgcagtt gccgcagcat tgttagtgct tatattcacc       960
     atcatcggcc attgctgcgg ctgtttatct aataacagaa agaaatacaa gcctcttgat      1020
     gctcctgctg tacctgaaaa aaatggctac gaaatgggat ataatcatca tcaaaactat      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page