(data stored in ACNUC6288 zone)

EMBL: CR382138.PE132

CR382138.PE132       Location/Qualifiers
FT   CDS_pept        complement(272630..275017)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03102g"
FT                   /old_locus_tag="DEHA0F03498g"
FT                   /old_locus_tag="DEHA-IPF8845"
FT                   /old_locus_tag="DEHA-CDS0851.1"
FT                   /product="DEHA2F03102p"
FT                   /note="similar to p|Q03254 uniprot|Q03254 Saccharomyces
FT                   cerevisiae YMR277W FCP1 Carboxy-terminal domain (CTD)
FT                   phosphatase essential for dephosphorylation of the repeated
FT                   C-terminal domain of the RNA polymerase II large subunit
FT                   (Rpo21p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88814"
FT                   /db_xref="GOA:Q6BMS0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS0"
FT                   /protein_id="CAG88814.2"
FT                   /translation="MAELTSITLPQSVPFPVTISSILCRQGETVPKHQTLFKYKYWDYQ
FT                   DDPNSKEETPPKIRVERIGTYESPIEGEVNSINVCLSDEIAHSGVELCFIKEPCAHAVQ
FT                   YGGLCALCGKAVEDEKDYSGYNYEDRATISMSHDNTGLKISLDEATKIEHNTTDRLSRE
FT                   KKLILVVDLDQTVIHATVDPTVGEWQSDPSNPNYPAVKNVRSFCLEEDPIAPPGWTGPK
FT                   LPPSKCWYYVKLRPGLEEFLRSASDLYEMHIYTMATRNYALAIAKIIDPEGEYFGDRIL
FT                   SRDESGSLTHKNLKRLFPVDQSMVVIIDDRGDVWQWENNLIKVVPYDFFVGIGDINSSF
FT                   LPKKFGQLTGPTKKRKSIAKLEALENEKNSTDDEESEANENDKEASEEDDNPSQENDTP
FT                   SSSPVDRILEMGGGEDNASLLMEQSISRNMSLEQQQHDRPLAKLQHDLDKIHEHDSHSP
FT                   SGSSSPEESDGDKKEEEDEEEDNLLYDDDNELYSLKKALVRIHSEYYKILAANKIKSPH
FT                   LKPDLTHIIPFLKSKCLEGITILFSGILPLGINLDTADIVIWCKQFGVKVVNEVYPEVT
FT                   HVVCRDPNANSFKSGPTFKVRVAKKILPNVKIVNPDWLFACLSAWGKVDETDYLVESEE
FT                   DNWYLEDKDLKKYQKGLESQKQKQINTIESRPRFDSIGSVEEYDLDNANQEVDDFLAGI
FT                   SEDDNSEKDDDDNDNDDDNNDNEDTDNDKAEVSKPFDSFIKDAYKVNKKRSLEADEDII
FT                   LQQEVTSKKQKTQQAEPESEVDLDELEKELLDGFDDMEEANV"
     atggcagaat tgacctcaat tactttgcca cagtcggttc cattcccagt gacaatatca        60
     tccattttat gtaggcaagg agaaactgtt cctaagcacc aaacattatt caaatataaa       120
     tactgggatt atcaagatga ccctaattca aaagaggaaa cgccgcccaa gattcgtgtg       180
     gaacgtattg gaacttatga aagcccaatt gagggagagg tgaatagtat caatgtatgt       240
     ttgagtgatg aaattgctca cagtggcgtc gaattatgtt ttattaaaga gccttgtgct       300
     catgccgtcc aatacggagg cctatgtgca ttgtgcggca aagcagtcga ggatgagaag       360
     gattattcgg gatataatta cgaagacagg gcaaccattt ctatgtctca cgataataca       420
     ggattgaaaa taagtctcga cgaagcaaca aagattgaac ataatacaac tgatagacta       480
     agtcgcgaga aaaagttgat cttggtcgtc gatttggacc aaactgttat tcatgcgact       540
     gtagatccga cggtagggga gtggcaactg gacccatcta acccaaacta tccagccgtg       600
     aaaaacgtca gaagtttctg tttggaggaa gacccaattg ctcccccagg atggacgggg       660
     ccaaaattgc caccatcaaa gtgttggtat tatgttaaat taaggcctgg gttagaggaa       720
     tttttacgac tggcatcaga tctctatgaa atgcatatat atacgatggc tactaggaat       780
     tacgctttgg ctattgcaaa aattattgat ccagaaggag aatactttgg tgacagaata       840
     ttgagtcgtg atgaaagtgg atcattgaca cataagaatt tgaagagact ttttccagtt       900
     gatcaatcta tggttgtaat catcgatgac agaggcgatg tatggcaatg ggaaaataat       960
     ttaattaaag tagtaccata tgacttcttt gttggaattg gtgatattaa ttctagcttt      1020
     ttgcctaaga agtttggcca actaactggc ccaactaaga aaagaaaatc aattgcaaag      1080
     ttagaagcgc ttgaaaacga aaaaaattcc accgatgatg aagaatctga agcaaatgaa      1140
     aacgataaag aggctagtga agaggacgat aacccgagcc aggagaatga cactccatct      1200
     tcatcacctg tggatagaat attagaaatg ggaggaggag aagataatgc aagtttactt      1260
     atggaacaat ctataagtag aaatatgtct ttggaacaac aacaacatga cagaccttta      1320
     gcaaagttac aacatgattt ggacaaaatc catgaacatg attctcattc tccatctggt      1380
     tcaagttcac ctgaagaaag tgatggtgat aaaaaagaag aagaggatga ggaggaagat      1440
     aatttattgt acgacgatga taatgagtta tactcgttga agaaggcgtt agtgagaatt      1500
     cattcagaat attacaaaat attggctgca aacaaaataa aaagtccaca tttaaagccc      1560
     gatttaacac atattattcc atttttaaag agcaaatgtt tagaaggcat cacaattcta      1620
     ttttctggta ttttgccatt aggtataaat ttagatacgg ccgatattgt catttggtgt      1680
     aagcaatttg gtgtcaaggt agtgaacgaa gtatatcctg aggtgacaca tgtggtatgt      1740
     agggatccaa atgcaaattc atttaagtct ggcccaacgt tcaaggttag ggttgcaaag      1800
     aagatcttac caaacgtgaa gatagtgaac ccagattggc tatttgcttg cttgagtgcc      1860
     tggggaaagg tggatgaaac agattactta gttgaaagcg aagaagataa ttggtaccta      1920
     gaagacaagg atctcaaaaa ataccaaaag ggattagaat ctcaaaagca gaaacaaatc      1980
     aatacaattg aaagcagacc caggtttgat tctatcggtt ccgtagaaga atatgatttg      2040
     gacaatgcga atcaagaggt tgatgatttc ttggcaggaa taagtgaaga tgacaattca      2100
     gaaaaggatg atgatgataa cgacaatgac gacgacaata acgacaatga agacaccgac      2160
     aacgacaagg ctgaagttag caaaccgttc gattcattta ttaaagatgc atacaaggtt      2220
     aataaaaaga gaagtctaga ggctgacgaa gacataatct tgcaacaaga agttacatct      2280
     aagaaacaaa agacacaaca agccgaacca gagagcgagg tggacttgga cgaactcgaa      2340
     aaggaacttt tggatggctt cgacgacatg gaagaggcca atgtatga                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page