(data stored in ACNUC6288 zone)

EMBL: CR382138.PE134

CR382138.PE134       Location/Qualifiers
FT   CDS_pept        complement(277517..278614)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03146g"
FT                   /old_locus_tag="DEHA0F03542g"
FT                   /old_locus_tag="DEHA-IPF8839"
FT                   /old_locus_tag="DEHA-CDS3520.1"
FT                   /product="DEHA2F03146p"
FT                   /note="similar to uniprot|P48510 Saccharomyces cerevisiae
FT                   YMR276W DSK2 Nuclear-enriched ubiquitin-like polyubiquitin-
FT                   binding protein required for spindle pole body (SPB)
FT                   duplication and for transit through the G2/M phase of the
FT                   cell cycle involved in proteolysis interacts with the
FT                   proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88816"
FT                   /db_xref="GOA:Q6BMR8"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR8"
FT                   /protein_id="CAG88816.1"
FT                   /translation="MSDTISITIKSSGDTKYEVTVSPTITVLELKNEIADKSSVPADRQ
FT                   RLIYSGKVLKDTETVASYKVQTGHTIHLVKSAGPKTNNTDNRGAASTDAPRNESESSGN
FT                   NSGVPSNIAAGQGSFNPLADLTGARYAGYTQLPSASMFGPDGGMNSGMPDPEQMSEMMS
FT                   NPMFQESMNSMLSNPQMLDYMINQSPQLRAMGPQAREMLQSPLFRQMMSNPEMMRSMMQ
FT                   MGRGGAGGAGGFPGFGGQGGAGAFPAPGANPTVDSSDDNNATGAANENTNASTNAPANP
FT                   FASMFPGGMPPMDPFALLGGAGGAGGAGAGQAAPQDTRPPEERYEEQLRQLNDMGFFDF
FT                   DRNVAALRRSGGSVQGAVEYLLSSI"
     atgtctgata caatttcaat aaccattaag tcttcagggg atactaagta tgaagttaca        60
     gtatcaccaa caataacagt tctcgaatta aagaatgaaa ttgcagataa gtcatccgtt       120
     ccagcagatc gccagagatt gatttactca ggaaaagttt tgaaagatac agagacagtt       180
     gcgtcgtaca aggtacaaac tggacatacg atccatcttg ttaaaagcgc tggtcctaag       240
     acaaataata cagataacag aggagctgcc tccacagatg ctccgaggaa cgagagcgaa       300
     tcgagcggca ataacagtgg ggttccatca aatattgcag caggccaagg ttcatttaat       360
     ccattagcag atttaactgg ggcacgttat gctggttaca cccaattgcc ttcagcttcc       420
     atgtttgggc cagatggggg tatgaattcc ggtatgccag atccagaaca gatgtcggaa       480
     atgatgtcaa atcctatgtt ccaagaaagc atgaattcaa tgttgtcaaa tcctcaaatg       540
     ttagattata tgataaatca atctcctcaa ttaagggcta tgggtccaca agcgagagaa       600
     atgttgcaaa gtccactttt cagacaaatg atgtcgaatc cagaaatgat gagatccatg       660
     atgcaaatgg gtagaggtgg cgctggtgga gcgggtggat tcccaggatt tgggggtcaa       720
     gggggagctg gtgctttccc tgcaccaggt gcaaacccta ctgtcgactc tagcgacgat       780
     aataatgcca ctggtgccgc taacgaaaat acaaatgcaa gtacaaacgc acctgctaat       840
     ccatttgctt ctatgtttcc tggaggaatg cctccaatgg atccgtttgc tttactaggt       900
     ggagccggtg gagccggtgg cgctggtgca ggccaagctg ctcctcaaga tacccgccca       960
     cctgaagaaa gatacgaaga gcaattgagg caattaaacg acatgggctt ttttgacttt      1020
     gatagaaatg ttgctgcttt gaggagaagt ggaggcagtg tgcaaggggc tgttgaatat      1080
     cttttgtcaa gtatttag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page