(data stored in ACNUC6288 zone)

EMBL: CR382138.PE139

CR382138.PE139       Location/Qualifiers
FT   CDS_pept        join(283536..283560,283638..284149)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03256g"
FT                   /old_locus_tag="DEHA0F03630g"
FT                   /product="DEHA2F03256p"
FT                   /note="weakly similar to uniprot|P34232 Saccharomyces
FT                   cerevisiae YKL186C MTR2 mRNA transport regulator essential
FT                   nuclear protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88820"
FT                   /db_xref="GOA:Q6BMR4"
FT                   /db_xref="InterPro:IPR019488"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR4"
FT                   /protein_id="CAG88820.1"
FT                   /translation="MSNIQRDPKPYLKKILSSLDIQYQGPSQQFPNVESYATQFGKQLK
FT                   PQCAIIMNGKPLIPTNNDAKLEFQKKWLLSPLTFHQLNSFDSHLIPGTGTFVINASGKV
FT                   KFDESGRNRLGETSDLIHPINNATVKGRPVWGSWFGFNLNLIVDESILNNPESEAINSY
FT                   NYRFTYKPDDSVIQI"
     atgtcaaaca tacaacgaga tccaaagcca tacttgaaaa agatattatc gtcgttagat        60
     atacagtatc aggggccatc acagcaattt ccaaatgttg aatcatacgc tacacagttt       120
     gggaaacaac tcaagccgca atgtgcaatt attatgaatg ggaaaccatt gatacccaca       180
     aataatgatg caaaattgga atttcaaaaa aaatggttgt tatcgccatt gacgtttcat       240
     cagttgaata gttttgacag ccatttaata cctggcacag gaacatttgt tataaatgcc       300
     agtggtaaag taaaatttga tgaaagtggt agaaacaggc ttggggaaac gtccgatttg       360
     atacatccta taaataatgc cactgttaaa gggagacctg tctggggatc atggtttggt       420
     tttaacttga atttgatagt agacgaatcc attttgaaca accccgaaag tgaggcgatt       480
     aatagttaca actacagatt tacatacaaa cctgatgata gtgtgattca aatttaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page