(data stored in ACNUC6288 zone)

EMBL: CR382138.PE141

CR382138.PE141       Location/Qualifiers
FT   CDS_pept        complement(286296..287087)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03300g"
FT                   /old_locus_tag="IPF_8828"
FT                   /product="DEHA2F03300p"
FT                   /note="highly similar to uniprot|P05753 Saccharomyces
FT                   cerevisiae YJR145C RPS4A Protein component of the small
FT                   (40S) ribosomal subunit and highly similar to
FT                   uniprot|P05753 Saccharomyces cerevisiae YHR203C RPS4B
FT                   Protein component of the small (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88822"
FT                   /db_xref="GOA:Q6BMR2"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR2"
FT                   /protein_id="CAG88822.1"
FT                   /translation="MGRGPKKHLKRLAAPSHWMLDKLSGTYAPRPSAGPHKLRESLPLV
FT                   IFLRNRLKYALNGREVKAILMQEHVKVDGKVRTDATFPAGFMDVITLEATNEHFRLIYD
FT                   VKGRFTVHRITAEEASYKLAKVKKVQLGKRGIPYVVTHDGRTIRYPDPLIRANDSVKVD
FT                   LATGKITDFISFDTGRLVMVTGGRNMGRVGVITHREKHEGGFDLVHIKDSLENTFVTRL
FT                   TNVFIVGTEAGKPHISLPKGKGIKLSISEERDRRRNQQLIN"
     atgggtagag gtccaaagaa gcacttgaag agattagcag caccatccca ctggatgttg        60
     gacaaattgt ccggtactta cgcaccaaga ccatctgctg gtcctcacaa attgagagaa       120
     tctttaccat tggttatctt cttaagaaac agacttaagt atgccttaaa cggtagagaa       180
     gtcaaggcca tcttgatgca agaacacgtc aaggttgatg gtaaagttag aaccgatgct       240
     actttcccag ctggtttcat ggatgtcatc actttagaag ctaccaacga acacttcaga       300
     ttaatctatg atgtcaaggg tagattcact gtccacagaa tcactgctga agaagcttct       360
     tacaagttag ctaaggtcaa gaaggtccaa ttaggtaaga gaggtattcc atacgttgtc       420
     acccacgacg gtagaactat cagataccca gatccattga tcagagccaa cgattccgtt       480
     aaggttgact tagctaccgg taagatcact gactttatca gctttgacac tggtagatta       540
     gtcatggtta ctggtggtcg taacatgggt agagttggtg ttatcaccca cagagaaaag       600
     cacgagggtg gtttcgattt agtccacatc aaggattctt tggaaaacac tttcgttacc       660
     agattaacta acgtcttcat cgtcggtact gaagctggta agccacacat ttctttacca       720
     aagggtaagg gtattaagtt atccatctct gaagaacgtg acagaagaag aaaccaacaa       780
     cttatcaact aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page