(data stored in ACNUC6288 zone)

EMBL: CR382138.PE143

CR382138.PE143       Location/Qualifiers
FT   CDS_pept        complement(290147..291370)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03344g"
FT                   /old_locus_tag="DEHA0F03718g"
FT                   /old_locus_tag="DEHA-IPF8824"
FT                   /old_locus_tag="DEHA-CDS3035.1"
FT                   /product="DEHA2F03344p"
FT                   /note="some similarities with uniprot|P42933 Saccharomyces
FT                   cerevisiae YMR191W SPG5 Protein required for survival at
FT                   high temperature during stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88824"
FT                   /db_xref="GOA:Q6BMR0"
FT                   /db_xref="InterPro:IPR038816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR0"
FT                   /protein_id="CAG88824.2"
FT                   /translation="MRSQTMKNLISLKKNITRRIKQTLEEIAENLGHPQQRPVPVPIPI
FT                   PVRSGRNASRLSKQFSRYYSTSSNFTGGHYKFRAFQFLNVKYQNGGKLGRIIQNNSNWI
FT                   RFNIQNSNFNQYRSFRTFHKSFLYNNFSQRYQSQFGNKMANMNFFRHPNGSSPIKNLNL
FT                   NIRAFMNSKKFDTSDPSTYKQDLVLHSRPQVKSNIRLNVSLTPKFSELTLSMARTVSSA
FT                   GCEETSHNTQTSNGCYVDFPMSSKFSIPAMTILNNEILDELMQDLKILESKIAELKSDL
FT                   QNLFELGELPMKYLHDQNIIRVYFANCDKARLESLLREKNIINGIIYEEAVYGCSSDCA
FT                   NVSEADILSSYYGSSSSLGSSTEYDDDVLSDSSHHPLSNDHIIRPESGNQSQNSQHVSF
FT                   CDEDICWV"
     atgaggtcgc agacaatgaa aaacttgatt tctttgaaga aaaatatcac tcggaggatc        60
     aagcaaaccc ttgaggagat agcagagaat ttaggtcatc cacaacaacg cccagtgcca       120
     gttccaatac ctataccagt tagaagcggt agaaatgcaa gcagattaag caaacaattt       180
     tctagatatt atagcacatc aagtaacttt actggtggtc attataagtt ccgggcattc       240
     cagtttttga atgtgaagta ccagaatgga ggaaagttgg gaagaataat ccagaataat       300
     tcgaactgga tcagattcaa tatccagaat tctaatttca accaataccg atcatttaga       360
     acgtttcaca agtcatttct ttacaataat ttttcgcaga gataccaatc acagtttggt       420
     aacaaaatgg cgaacatgaa ctttttcagg catcctaatg gtagctcacc aatcaagaat       480
     ttgaatctca acatcagggc gttcatgaat tcgaagaagt ttgatacttc tgaccctagc       540
     acgtacaaac aagacttggt attgcatctg agacctcaag tcaagagcaa catacgcctt       600
     aatgtatctt tgactccaaa gttctctgaa ctcaccttgc tgatggcaag aactgtttcc       660
     tctgctggct gtgaggagac atctcataat actcagactt ccaatggatg ctacgttgat       720
     ttcccaatga gtagtaaatt ttccattcca gcgatgacta tcttgaacaa tgaaatactc       780
     gatgaattaa tgcaagactt gaaaattctc gaatccaaga ttgctgaatt gaaactggat       840
     ttacagaact tgttcgagtt aggggagtta cctatgaaat atttgcacga tcaaaatatt       900
     attagggtct actttgctaa ttgcgataaa gcaagattag aaagcttgtt gagggaaaag       960
     aatatcataa acgggataat ttatgaagaa gctgtttatg gatgttcttc agactgtgca      1020
     aacgtctccg aggctgatat tttaagttcc tattacggct cgtcatcttc gctcggttct      1080
     tccacagaat atgacgatga tgtcttatct gactcttctc atcatccctt gtcaaatgac      1140
     cacattatca gaccagagag cggaaatcaa tctcaaaact cacaacatgt tagcttttgc      1200
     gacgaggaca tatgttgggt ttga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page