(data stored in ACNUC6288 zone)

EMBL: CR382138.PE150

CR382138.PE150       Location/Qualifiers
FT   CDS_pept        316263..317672
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03498g"
FT                   /old_locus_tag="DEHA0F03872g"
FT                   /old_locus_tag="DEHA-IPF8801"
FT                   /old_locus_tag="DEHA-CDS2573.1"
FT                   /product="DEHA2F03498p"
FT                   /note="weakly similar to uniprot|Q12468 Saccharomyces
FT                   cerevisiae YDL216C RRI1 subunit of COP9 signalosome (CSN)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88831"
FT                   /db_xref="GOA:Q6BMQ3"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR037740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMQ3"
FT                   /protein_id="CAG88831.2"
FT                   /translation="MRCIHELADVFINDSDERILTQSLDATEIDKHADYESFFSINSDE
FT                   SIMKARPWKSNAKYFKKTYISSLALCKMSVHAKSGGAIEVMGMMTGKIIKNSIIVMDVY
FT                   PLPVEGTETRVNAQAEGYEYMVQYLENSKQVGRDENIVGWYHSHPGYGCWLSGIDVATQ
FT                   SLNQNFQDPYLAIVIDPMKTEDQGKVEIGAFRTFPDNYKSPDSAAPTNNTRGVPPSKQK
FT                   DFGVHSDKYYSLDIQIFKSNLDTEILNIISNKSWIGKLIKSVNTANHQEQNMIENVFKL
FT                   INKLQKKEVNQLNRFEISFIKKFDLIFEDIISKKLMNDNRFYSTISQSSYDSFSGHGNS
FT                   SSNDEMDDESDLDDRDKSSAPLDISDTGNDDVMSMESSVNVYTDKRGDDNDDDDDNDGY
FT                   DKRPMYTNYRSRANLTKPRKSGSSPEEHVKLSNNVNKTITNISNHSKDIGLTELQDLIA
FT                   LKTKESIFLGK"
     atgcgatgca ttcatgaact cgcagatgta ttcataaatg attcagatga gagaatcctc        60
     acacagctgt tagatgctac ggagatagat aaacatgctg attatgaatc ttttttttcc       120
     attaactctg atgagagtat aatgaaggca agaccttgga agtcaaatgc caaatacttc       180
     aagaaaacat atatatcttc gttagcatta tgtaaaatgt cagttcatgc caaatcagga       240
     ggtgcaattg aagttatggg gatgatgact ggcaagatta ttaaaaactc aataattgtg       300
     atggatgttt atccattgcc agttgagggt accgagacaa gagttaatgc tcaggcagaa       360
     ggttatgaat atatggtgca atatctagaa aacctgaaac aagtgggtag agatgagaat       420
     attgttggat ggtatcattc acatccaggt tatggctgtt ggttgtctgg tatagatgtt       480
     gcaacgcaaa gtttgaacca gaatttccaa gatccgtatc tagctatagt tattgatccg       540
     atgaaaacag aggaccaagg aaaagttgag attggggcct tccggacctt tcctgataat       600
     tacaaatccc ctgattccgc tgcacctact aacaatacta gaggagtccc cccgtccaaa       660
     cagaaagatt ttggggttca ttcggataag tactattcat tagatatcca aatcttcaag       720
     tccaatctag atactgaaat tctaaacatc atatcgaaca aatcgtggat cggcaaacta       780
     atcaaatcgg tcaacacagc gaatcatcaa gaacaaaata tgatagaaaa cgtattcaag       840
     ttgatcaata aacttcagaa gaaggaagtc aatcaattga acaggttcga aatctcgttt       900
     atcaaaaaat tcgacttgat ctttgaagac ataataagca agaagcttat gaatgacaat       960
     agattctaca gtacaatatc acagagttcc tatgacagct ttagtgggca tgggaattca      1020
     tcaagcaacg atgaaatgga cgacgaaagc gatctcgatg acagagacaa gagcagtgca      1080
     cccctagaca tttctgacac gggaaacgac gacgttatgt ccatggaaag ctcggtcaac      1140
     gtctacacag acaagagagg agatgacaat gacgatgatg atgacaacga cggctatgac      1200
     aaaagaccca tgtacaccaa ttatagatca agagcaaatc taaccaagcc acgaaaactg      1260
     ggttcctcgc cggaagaaca tgtgaagtta ctgaataacg taaataagac catcacaaac      1320
     atatctaatc atagtaaaga tataggtctt acagaactac aggacttgat agccctaaag      1380
     accaaagagc tgattttttt gggcaaataa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page