(data stored in ACNUC6288 zone)

EMBL: CR382138.PE154

CR382138.PE154       Location/Qualifiers
FT   CDS_pept        complement(323850..324503)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03586g"
FT                   /old_locus_tag="DEHA0F03982g"
FT                   /old_locus_tag="DEHA-IPF8796"
FT                   /old_locus_tag="DEHA-CDS5185.1"
FT                   /product="DEHA2F03586p"
FT                   /note="weakly similar to uniprot|Q02774 Saccharomyces
FT                   cerevisiae YDL212W SHR3 Endoplasmic reticulum packaging
FT                   chaperone required for incorporation of amino acid
FT                   permeases into COPII coated vesicles for transport to the
FT                   cell surface and similar to CA0700|CaSHR3 Candida albicans
FT                   CaSHR3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88836"
FT                   /db_xref="GOA:Q6BMP9"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP9"
FT                   /protein_id="CAG88836.1"
FT                   /translation="MAYKDIVPVGSGLIIGATSFGLGVLYANLPYDVNTLWRQDETGTA
FT                   FITSLAHYSVWGNSPAYVHHIFHSVIGLGFIGAFIKLYKPSEDAKYFEYGSLFLYMVGV
FT                   IIYLTNLRIGVNSCLAGDWGEVDMPTGINVMAASQVMIGFALFGVLLLQGGLYYAEWYD
FT                   NRLKVKFFEEEERAALAAASAKTDNLAESEVVGSKGASASGASASSTKAKKKSK"
     atggcttaca aagatatcgt tccagttgga tctggattaa ttattggtgc tacgtcgttt        60
     ggattgggtg tactctatgc caatttgccg tacgacgtga atacgttatg gagacaagat       120
     gagacaggga ctgctttcat aacatcattg gcacattata gtgtttgggg taactcacca       180
     gcatatgtcc atcatatttt ccactctgtt attggattag gattcattgg tgcattcatc       240
     aagttgtaca agccaagtga agatgctaag tactttgagt atggttcttt gtttttgtac       300
     atggtaggtg tgattattta cttgaccaac ttgagaattg gtgttaacag ttgcttggct       360
     ggagattggg gtgaagttga catgcctact gggatcaatg ttatggctgc gtcgcaagtg       420
     atgattggat ttgcgttatt tggtgtttta ttattgcaag gaggattata ctacgccgaa       480
     tggtatgaca acagattgaa ggttaagttc tttgaagaag aagaaagagc agctcttgct       540
     gctgcttctg ccaagacaga caacctcgcg gagagtgaag tcgtgggaag taaaggtgct       600
     tctgcttccg gtgcttctgc ttcctccacc aaggccaaga agaagtcgaa atag             654
//

If you have problems or comments...

PBIL Back to PBIL home page