(data stored in ACNUC6288 zone)

EMBL: CR382138.PE158

CR382138.PE158       Location/Qualifiers
FT   CDS_pept        complement(327815..329362)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03674g"
FT                   /old_locus_tag="DEHA0F04070g"
FT                   /old_locus_tag="DEHA-IPF8792"
FT                   /old_locus_tag="DEHA-CDS2228.1"
FT                   /product="DEHA2F03674p"
FT                   /note="similar to uniprot|P53877 Saccharomyces cerevisiae
FT                   YNL182C IPI3 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88840"
FT                   /db_xref="GOA:Q6BMP5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMP5"
FT                   /protein_id="CAG88840.2"
FT                   /translation="MDESVFYISEGDPADKHSQESFGHSSSVHSSQQHAGFRQADCPQN
FT                   GACLSGVGTGERLFVASPNKALINVYSWGKESPDQRIPIPEQLSCLTLCKHPRIKVSEG
FT                   RQSDERNLPSFRTPWLLAGGSKTGKIYVWELASGNLLCVKEAHYQAITAIKFSQCGTFL
FT                   VSGSSDARCMVWRTSDLISVYNKDEESSINIKPFASFTDHSLPITDLAISEAGIISDLR
FT                   LYTVSRDSTLRIYDIMTKSLLTTFVLPSGIECVTKDPANRACYVGLSNGLIRTVPLYQI
FT                   NPNTSVLESIGGRGKIVTLDTDPNLLSTFVHHQQRLSTEPLHKTLNKKTTTEEKPILVT
FT                   RLSITMDGSNLISGDSAGRVYVSDIVSRQVVKTFAPCKSSISYIQVNACAAEKVSVSNT
FT                   SSNNNDKRHRLIPQFKRVLANPDPLEHQLYMEIPKQQEDEEDFESWLARKSQEELEFRN
FT                   LTHINSSVTVTGAAPTTNDSTVKELEEKLAKVSKAYTDLRGKHEELYEEHNRLLSDS"
     atggacgagt ctgtattcta tatatcggag ggagatccag ctgacaagca ttcacaggag        60
     tcgtttgggc attctagctc ggtgcattcg tctcagcaac atgctggatt tagacaggcc       120
     gattgtcctc aaaatggggc ctgtttaagt ggtgtaggaa caggagaaag actttttgtt       180
     gcaagcccga ataaggcttt gattaatgtt tactcgtggg gcaaagaaag tcccgaccaa       240
     agaattccaa ttccagaaca attgagttgt ttgactttat gcaagcatcc tcgcatcaag       300
     gtgctggagg gacgccaatc agatgaacgt aacttaccaa gtttcaggac tccgtggtta       360
     ttagcaggtg gatccaagac agggaagata tatgtgtggg agttggcatc gggaaattta       420
     ttgtgtgtca aagaagcaca ttaccaagcg atcacggcta ttaaattctc tcaatgtggc       480
     acatttttgg tatctggaag ttcggatgct agatgtatgg tttggagaac gagtgattta       540
     atatcggtat acaacaaaga tgaagagtcg agtataaata tcaagccatt tgcatcgttc       600
     acagaccatt cattaccaat aacagatttg gcaatatcag aagcaggaat tatcagtgat       660
     ttaagattat acaccgtctc tcgtgatagt actttacgaa tttatgatat tatgacaaag       720
     tcccttttaa caacatttgt gttgccttct ggtattgaat gtgtgactaa agatcctgcg       780
     aacagagcct gttatgttgg gttatcaaac ggtctaatca ggacggtccc attataccaa       840
     attaacccaa acacgtcagt attagagagt ataggaggta ggggtaagat agtcactttg       900
     gatactgatc ctaatttatt aagtaccttt gtccaccatc aacaacgttt aagcaccgaa       960
     ccattgcata aaacattaaa taaaaagacg accacagaag aaaaaccaat cctagtaacg      1020
     aggttatcca tcacaatgga tggttctaat ttgatatctg gtgattcggc cggtagagtg      1080
     tacgtttcgg atattgtttc tagacaagtc gttaaaactt ttgcaccatg taaatcttct      1140
     atctcatata tccaggttaa tgcttgtgcg gccgaaaagg tatccgtttc aaacacctca      1200
     tctaacaaca acgataaaag acatagatta attccccaat tcaaaagagt tcttgctaat      1260
     cctgatccgt tagaacatca actctatatg gaaattccta aacaacagga agatgaagag      1320
     gattttgaaa gctggttagc acgtaaatca caagaagaat tggaattcag gaatttgaca      1380
     catataaatt cctcagttac tgtaacaggt gctgctccaa ctacaaacga ttcgacggtt      1440
     aaggaattag aagaaaaact cgcaaaagta tcaaaggcct acactgattt gagaggaaaa      1500
     cacgaagagt tgtatgaaga gcataataga ttactcagtg attcataa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page