(data stored in ACNUC6288 zone)

EMBL: CR382138.PE159

CR382138.PE159       Location/Qualifiers
FT   CDS_pept        329553..330968
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03696g"
FT                   /old_locus_tag="DEHA0F04092g"
FT                   /old_locus_tag="DEHA-IPF8790"
FT                   /old_locus_tag="DEHA-CDS2556.1"
FT                   /product="DEHA2F03696p"
FT                   /note="similar to uniprot|P53878 Saccharomyces cerevisiae
FT                   YNL181w protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88841"
FT                   /db_xref="GOA:Q6BMP4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP4"
FT                   /protein_id="CAG88841.2"
FT                   /translation="MPIDILGTAIYEGPEAIPGWEYIKTYTPAIMALAGIKYYFGGTSN
FT                   TWERDYHGKVYIMTGATSGLGANLAYELASKGAQLILLVRSTEDSWLVDYIEDLRERTD
FT                   NFMIYAEECDLNSLYSIRKFATKWLDNQPPRRLDGVICCAAESIPIGKARQVTVDGVEK
FT                   QMGINYLAHFHLLTLLSPALKIQLPDRDVRIVMATCVSQALGDLDMKDALWLNRRYPTR
FT                   EPWKLYGTSKLMLTMFAKEFQRRLNSFERKDKAPCNVRVNMVNPGIMRTPSTRRFLSMG
FT                   AIWGLLVYFVLFPIFWIFFKSTTQGAQSFLYALAAPVFKNLDGGNVIQECKILKPARKE
FT                   LSDEDLQKALYDETEKLLEALEKSSAIERKRQEKIQESKMPLADKLRAQNEESRKKADI
FT                   HTKPESPEELQAKLASLKRSIGIPSDANDELPLFPSQPNSSQSESRAENLSTTKSTPKS
FT                   KSKAKKSKSKKID"
     atgccaatag acatactagg tacagccata tatgagggac cggaagcaat tccaggatgg        60
     gagtatatca agacttatac tccagcaatt atggcccttg caggtattaa gtactacttt       120
     ggtggaactt caaatacttg ggaaagagat tatcatggaa aggtatatat catgactgga       180
     gctacttctg gattgggtgc aaatcttgcg tatgaacttg caagtaaggg agcacaactt       240
     attctcttgg tgagatctac cgaagacagt tggctcgtag actatattga agacttgaga       300
     gagagaacgg ataactttat gatttatgct gaagaatgtg atttgaattc gttatattct       360
     ataagaaaat ttgccacgaa atggttggat aatcaacccc caagaagatt ggacggtgtg       420
     atatgctgcg ccgctgaatc tattcctatt ggaaaggcaa gacaagttac ggtggatggt       480
     gttgagaagc aaatgggaat caattactta gcacatttcc atttgttgac gttactttct       540
     cctgctttga aaatacagct tccggacagg gacgttagga ttgtgatggc cacttgtgta       600
     tctcaagcct taggggacct cgatatgaag gatgctttgt ggttaaatag acgttatcct       660
     actagagaac cctggaagtt atacggtaca tccaaattaa tgttgacgat gtttgccaaa       720
     gaattccaga gaagattgaa tagctttgag agaaaggaca aggctccttg taacgtcaga       780
     gtcaacatgg tcaaccccgg aatcatgaga actccatcca caagaagatt tttatcgatg       840
     ggagcgattt ggggactttt ggtctatttc gttttgttcc caatattctg gatctttttc       900
     aaaagcacca ctcaaggagc ccagtcgttc ttgtacgcgt tggctgcgcc cgtgtttaaa       960
     aacctcgacg gtggaaatgt tatccaagaa tgcaaaatat taaagccggc ccgtaaagag      1020
     cttagcgacg aagacctcca aaaggccttg tacgatgaga ctgaaaagct ccttgaagca      1080
     ttggaaaaga gctcggctat cgagagaaaa agacaggaaa aaattcaaga gtctaaaatg      1140
     cccttagcag ataaattgag agcccaaaac gaagaatcca ggaaaaaagc tgatatccac      1200
     accaagcccg aaagcccaga agagttgcaa gcgaagctcg catccctcaa aagactgatt      1260
     ggaattccat cagacgctaa cgatgaattg ccattatttc catcccaacc caattcatct      1320
     caatctgaat ctcgggccga aaatttatcg actacaaaat ctacccctaa atcaaaatct      1380
     aaggctaaaa aatccaagtc taaaaagata gattag                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page