(data stored in ACNUC6288 zone)

EMBL: CR382138.PE161

CR382138.PE161       Location/Qualifiers
FT   CDS_pept        complement(334136..334567)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03740g"
FT                   /old_locus_tag="DEHA0F04136g"
FT                   /old_locus_tag="DEHA-IPF8786"
FT                   /old_locus_tag="DEHA-CDS6233.1"
FT                   /product="DEHA2F03740p"
FT                   /note="highly similar to uniprot|P53875 Saccharomyces
FT                   cerevisiae YNL185c MRPL19 ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88843"
FT                   /db_xref="GOA:Q6BMP2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP2"
FT                   /protein_id="CAG88843.2"
FT                   /translation="MSAKNVMVKLIVGAGQAAPAPPVGPALGSKGVKAIDFCKEFNART
FT                   GNYQPGIPIPCLLTIKPDRSFTFEMKSPPTSWLLLKAAQAKKGSDKPTHNIVGEVSLKH
FT                   VYEIAKIKKTDDRHKEVDLQAICGAVISTAEAVGVKIVP"
     atgtcagcta agaatgttat ggttaaattg attgtgggcg ctggacaagc ggcgcctgct        60
     cctccggttg gtccagcgtt aggttccaag ggtgttaagg ccatagattt ttgtaaagaa       120
     ttcaatgcaa gaactggtaa ttaccaacca ggtattccaa ttccatgctt attaaccatt       180
     aagcctgata gatcattcac ttttgagatg aagtcaccgc ctacttcatg gttgttatta       240
     aaagcagcac aagctaaaaa gggatcagat aagccaacgc ataatatagt gggtgaagtc       300
     tcgttgaaac atgtgtacga aatcgctaag attaagaaaa cagacgacag acataaggaa       360
     gtagacttac aagcgatctg tggtgcggtg attctgactg ctgaagcagt tggtgttaaa       420
     atcgttcctt ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page