(data stored in ACNUC6288 zone)

EMBL: CR382138.PE164

CR382138.PE164       Location/Qualifiers
FT   CDS_pept        complement(338944..342051)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03806g"
FT                   /old_locus_tag="DEHA0F04202g"
FT                   /old_locus_tag="DEHA-IPF8779"
FT                   /old_locus_tag="DEHA-CDS0399.1"
FT                   /product="DEHA2F03806p"
FT                   /note="similar to uniprot|P49095 Saccharomyces cerevisiae
FT                   YMR189W GCV2 P subunit of the mitochondrial glycine
FT                   decarboxylase complex required for the catabolism of
FT                   glycine to 5 10-methylene-THF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88846"
FT                   /db_xref="GOA:Q6BMN9"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN9"
FT                   /protein_id="CAG88846.2"
FT                   /translation="MISRVVARSARANRLSTLTRSVPRAYNLNLKLAASNRFLASKADT
FT                   SSADYEKVYDPSAKTVSLGNLDTFARRHLGPTPENVKTMLSALGYKDLDEFLSKAIPEH
FT                   VLYKRALQIQPQQGFTESEMLEHLHNLANKNKIVKSFIGKGYAGTKVPPVIQRNLLESP
FT                   EWYTSYTPYQPEISQGRLESLLNYQTMVTSLTGLNMANASLLDEGTAAGEAMSLSFHSL
FT                   KGKRGKYAVDTNLHPQTLDVMKSRAENIGVEIVELPLSTQEGLEELERIASDSCGALVQ
FT                   YPGTDGSLNNYTKVGEIVHAHKGLFAMATDLLALTLIKSPAEFNADIALGTSQRFGVPF
FT                   GYGGPHAAFFATNMKYSRKIPGRIVGLSKDRLGKPALRLALQTREQHIKREKATSNICT
FT                   AQALLANMAAMYAVYHGPKGLKDIASRVYGYTTVLANEISNNSQHEIVNDKWFDTLTVK
FT                   LGGGVKSDEILNKALNEYNINLFKAGEDKVSLCLDETVEEKDLIALVDVFTGNDSFSTS
FT                   SISELPKLPTELLRTDEILAHPVFNTHRSETSMLRYLHLLQSRDLSLANSMIPLGSCTM
FT                   KLNATVEMQTLSMPGFNQIHPFAPLNQAQGYKELVDEFEKDLNDITGFDATTNMPNSGA
FT                   QGEYTGLSLIRQYHKSKGEYEQRNICLIPVSAHGTNPASAAMCGLKVVPVKCLNNGSID
FT                   VDDLKVKAEKHAENLCSIMITYPSTYGLFEPGIKTAIDLVHNNGGLVYLDGANMNAQVG
FT                   LTSPGDLGADVCHLNIHKTFALSHGGGGPGQAPVCVKEHLKPFLPKHHFLDTPHSTNES
FT                   IQAVNSAPYGSASVIPVSYSYIKMLGAKALPHVSSIAMLNANYMLEKLKDDYQIMFVDH
FT                   SASTDEGLKHCAHEFILDLREFKAVGVEAIDVAKRLQDYGFHAPTMSFPVAGTLMIEPT
FT                   ESENLEELDRFINSLLSIRKEINAMANKEPLGQVLKNAPHSLNDIVSTSQADWEARGYT
FT                   REQAAYPLPFLKESKCWPSVSRVDDTYGDMNLMCTCPSVEEVAADQ"
     atgatttcaa gagttgttgc aagatcagct cgtgctaata gattgtctac attgactaga        60
     tctgttccaa gggcatacaa cttgaatttg aagcttgccg ctagtaacag atttttagct       120
     tccaaggcag atacttcatc cgctgactat gagaaggttt atgatccaag cgccaaaact       180
     gtctctttag gcaatttgga cacctttgct agacgtcatc ttggtcctac accagaaaat       240
     gtcaagacca tgttgtcagc tttgggatac aaggatttgg acgaattctt aagtaaggct       300
     atcccagaac atgttttata caagagagca ttacaaattc aaccacaaca agggttcacc       360
     gagctggaaa tgttagaaca tttacataac ttggccaata agaacaaaat tgtcaagtct       420
     tttattggta agggttatgc tggtactaag gttccaccag tgatccaaag aaacttattg       480
     gaatcaccag aatggtatac ttcttatact ccataccaac cagaaatctc gcaaggtaga       540
     ttagaatcat tattaaacta ccaaaccatg gttacttcct taactggttt aaatatggct       600
     aatgcttcat tattggatga aggtaccgct gcaggtgaag ccatgtcctt atcattccac       660
     agtttgaagg gcaaaagagg taaatatgcg gttgatacta acctccaccc tcagacttta       720
     gatgttatga aatctagagc cgaaaatatc ggagtagaaa ttgtcgaatt accattatct       780
     actcaagaag gtcttgaaga attagagagg attgcttctg attcgtgcgg tgccttagtt       840
     caatacccag gtactgatgg ttcgcttaac aactacacta aagttggtga gattgttcat       900
     gctcacaagg gtcttttcgc catggctact gatttattag ctttgacttt aatcaaatca       960
     ccagcagaat ttaatgccga cattgcattg ggtacttctc aaagattcgg tgttccattc      1020
     ggttacggtg gtccacacgc tgcatttttc gcaaccaaca tgaaatactc tcgtaaaatt      1080
     ccaggcagaa ttgttggttt atcaaaggat agattaggta aacctgcctt gagattagcg      1140
     ttacaaacca gagaacagca tattaagcgt gaaaaggcta cctctaatat ttgtactgct      1200
     caagctttat tagctaacat ggctgccatg tatgctgttt accatggacc aaagggattg      1260
     aaagacattg cttctagagt ttacggttac actactgttt tagctaatga aatctccaac      1320
     aattctcaac acgagattgt caacgataaa tggtttgata ccttaactgt taagttgggt      1380
     ggtggtgtta agtctgacga aatcttgaac aaggctctta acgagtataa tatcaattta      1440
     ttcaaggcag gcgaagataa ggtctccttg tgtttggatg aaactgtcga agaaaaggac      1500
     ttgattgcat tggtggatgt tttcacaggc aacgatctgt tcagcacatc gtcaatctca      1560
     gaattaccaa aattaccaac cgagttattg agaaccgacg aaatcttagc tcatccagtt      1620
     ttcaacaccc atcgttctga aacttccatg ttacgttact tgcatttatt gcaaagtaga      1680
     gatttatctt tggctaattc catgatccca ttaggttcat gtactatgaa attgaatgcc      1740
     accgttgaaa tgcaaacttt atctatgcca ggtttcaatc aaatacatcc atttgctccg      1800
     ttaaaccagg ctcaaggtta caaggaatta gtcgacgaat tcgaaaaaga tttaaatgac      1860
     atcactggtt ttgatgctac taccaatatg ccaaattctg gtgctcaagg tgaatacact      1920
     ggtttatcat taatcagaca atatcataaa tccaagggtg aatacgaaca aagaaacatt      1980
     tgtcttattc cagttagtgc tcacggtact aacccagcct ctgctgctat gtgtggatta      2040
     aaggttgttc cagtcaagtg tttgaataac ggttctattg atgtagatga cttgaaagtg      2100
     aaggccgaaa agcacgctga aaatctttgt tctatcatga tcacataccc atctacttac      2160
     ggtttattcg agccaggtat caagactgca attgaccttg tgcacaacaa cggtggttta      2220
     gtgtacttgg atggtgctaa catgaacgcc caagttggtt tgacttcgcc aggtgactta      2280
     ggtgcagatg tctgtcactt gaacattcac aagacctttg cattatccca cggtggtggt      2340
     ggtccaggtc aagccccagt atgtgtgaag gaacacttaa agccattctt accaaagcat      2400
     cacttcttag acactcctca ttccactaat gaatccatcc aagccgttaa ctctgctcca      2460
     tacggttctg cttcagttat cccagtttcc tactcgtaca tcaagatgtt gggtgccaag      2520
     gccttaccac acgtttcgtc tattgccatg ttgaacgcta actacatgtt agaaaagttg      2580
     aaggacgact accaaattat gttcgtcgac catagtgcct ccaccgacga gggattgaag      2640
     cactgtgctc acgagttcat cttggacttg agagaattca aggctgttgg tgttgaagcc      2700
     atcgatgttg ccaagagatt acaagattac ggcttccatg cccctaccat gtctttccca      2760
     gtggccggta cattgatgat tgaaccaacc gaatctgaaa acttggaaga attggacaga      2820
     ttcatcaact ccttattgtc catcagaaag gaaatcaatg ccatggccaa taaagaacca      2880
     ttaggccaag tattgaagaa tgctcctcat tcgttgaatg atatcgtctc cacttcccaa      2940
     gccgactggg aagccagagg ctacactaga gaacaggctg catacccatt gcccttcttg      3000
     aaggaatcta agtgctggcc ttccgtttcc agagtagacg atacttacgg tgacatgaac      3060
     ttgatgtgca cttgtccatc agttgaagag gttgccgcag accaataa                   3108
//

If you have problems or comments...

PBIL Back to PBIL home page