(data stored in ACNUC6288 zone)

EMBL: CR382138.PE166

CR382138.PE166       Location/Qualifiers
FT   CDS_pept        complement(345117..346769)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03850g"
FT                   /old_locus_tag="DEHA0F04246g"
FT                   /old_locus_tag="DEHA-IPF8775"
FT                   /old_locus_tag="DEHA-CDS1959.1"
FT                   /product="DEHA2F03850p"
FT                   /note="similar to uniprot|P53172 Saccharomyces cerevisiae
FT                   YGL056C SDS23 Spindle pole body protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88848"
FT                   /db_xref="GOA:Q6BMN7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR016711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMN7"
FT                   /protein_id="CAG88848.2"
FT                   /translation="MSNSFSFQRQNPGSPLQQHSPIHNINTGGNSNSVSNQSNNHPQTP
FT                   GHHVPSRKPSIVEMLSSPPPLPNTPDQEDIHSFSLSRNTSVSSRASSIYGNVNGGTSKG
FT                   SIVGVDWAEIPLVELTESNKLVSINSGFSVQKAFETLMEHNLTSVPVSLSKTDSTDLTN
FT                   CLTFDYSDVNTYLLLIMNKINLNDLSIYEGGDDVLSNQQKDSITKSINKAKKGEEVPVD
FT                   FIVKLHPKNPFVKFSEQDTLYKAMESLGNGVHRVAITNMNGTKITGILSQRRLIKYMWE
FT                   NARRFPSLDFYINSTLQDLKIGSNNPITIYEDQLLIEALLKMFTERVTSLAVVDKTMAL
FT                   IGNISIVDVKNVTSSKNSHLLFKSVLGFIGYNLTQKGIEEGQDQFPIFHVNNQSSLGRV
FT                   IAKLVATKSHRLWVVENRGSVHHGSVSSTSSSNSNSNSKSVTQSPKASPSTIESTLNQS
FT                   VSTPSNVQNIPPGSEPGGLPGKLVGVVTLTDILGLFASSKSNKKIDPQFARNQRRRSST
FT                   STTRSSFEGSSAGQDLFRKSYTTSAPAKTEGKR"
     atgtccaatt cattttcgtt ccagaggcaa aatcctgggt cacccttaca acagcattcg        60
     ccaattcaca atattaatac tggcggcaat tctaatagtg tcagtaatca aagtaataac       120
     catccacaga ctccaggtca tcatgttcca tctagaaagc catcgattgt ggagatgttg       180
     agttctccac ctccgcttcc caatactcca gaccaggagg atatccattc gttcagtttg       240
     agcagaaata cgtctgtgag ctcgcgggcg tcgtcgattt atggaaacgt gaacggtggc       300
     acgtctaagg ggtcaattgt gggcgtagac tgggcagaaa tcccgttggt ggagttgacg       360
     gagtcgaaca agttggtttc gatcaactcg gggttttcgg tccagaaggc gtttgagacg       420
     ttgatggagc acaatttgac gagtgtaccg gtgtcgttgt ccaagacgga ttcgaccgac       480
     cttactaact gtttgacatt cgattacagc gacgtgaata cctatctttt gttaattatg       540
     aataagatca atttgaatga tttgtcgatc tacgaaggag gcgacgatgt cttatcgaac       600
     cagcagaagg acctgatcac caagtcgatc aataaagcta agaagggtga agaggtgcca       660
     gtggacttca ttgtcaagtt gcacccaaaa aacccgtttg tgaaattcag cgagcaagac       720
     accttataca aggcgatgga gtcattgggt aatggggttc acagagttgc cataaccaat       780
     atgaatggca ccaagattac gggtatttta tcgcagagaa gattgattaa atacatgtgg       840
     gagaatgccc ggagatttcc atcgttggat ttctatatta attcgacctt acaggacttg       900
     aaaattggat caaataaccc catcacgata tacgaagatc aattattaat cgaagcttta       960
     ttaaagatgt tcaccgagag agttacgtcg ttagcagtgg tcgacaagac aatggcgtta      1020
     attggaaaca tttcaattgt cgatgtgaaa aatgttacca gttctaagaa ttcgcacttg      1080
     ttattcaaat cggttttggg atttattggt tacaatttga cccagaaggg tatcgaagaa      1140
     gggcaggatc aattccctat ctttcatgtt aataatcaat cgtcattagg ccgggttatt      1200
     gcaaagttag tcgctacaaa atcccatagg ctatgggttg ttgagaacag aggttcagtt      1260
     caccatggct ccgtgagttc gacatcaagt tccaattcca actccaactc aaaatcggtc      1320
     actcaatcac ccaaggcatc gccttctacc attgagagta cattaaatca actggtgtct      1380
     actcctagca acgtgcagaa cattccccca ggcagcgagc caggtggatt gccaggtaaa      1440
     ttagtagggg ttgtaacgtt gaccgatatc ttgggcttgt ttgcgtcgtc aaagtcaaat      1500
     aagaagatcg acccacagtt tgctaggaac cagagaagaa gatcgtcgac ttcgactacc      1560
     agatcgagct ttgaaggctc aagcgcaggc caggatcttt tcagaaaatc atataccaca      1620
     agtgctcctg ctaagactga aggcaaaaga taa                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page