(data stored in ACNUC6288 zone)

EMBL: CR382138.PE176

CR382138.PE176       Location/Qualifiers
FT   CDS_pept        complement(366261..369188)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04070g"
FT                   /old_locus_tag="DEHA0F04488g"
FT                   /old_locus_tag="DEHA-IPF8751"
FT                   /old_locus_tag="DEHA-CDS0485.1"
FT                   /product="DEHA2F04070p"
FT                   /note="similar to uniprot|Q12220 Saccharomyces cerevisiae
FT                   YLR129W DIP2 Nucleolar protein specifically associated with
FT                   the U3 snoRNA part of the large ribonucleoprotein complex
FT                   known as the small subunit (SSU) processome required for
FT                   18S rRNA biogenesis part of the active pre- rRNA processing
FT                   complex and highly similar to CA3927|CaDIP2 Candida
FT                   albicans CaDIP2 beta transducin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88859"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036085"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM8"
FT                   /protein_id="CAG88859.2"
FT                   /translation="MVKSYDRYEQEKCFGVIASQSNIVYLPPTSNQSSKTIGRAISSGL
FT                   EEILVWDIKTGEVLNRLRDGLTPGASNAPTAQAPSPVSYLAYHEDTNIVAAGYLDGSIK
FT                   IWDLTSGSALISFQGHKSSISILKFDRSGTRLLSGSNDATIILWDLVGEEGLFKLKGHK
FT                   SQITGLNFLTENPESKGSDDLEDYLLSVSKDGLIKLWEVKTQQCVETHLAHSNECWSLG
FT                   MNTSNNVAITTGNKDQVKVWEIDLSQPDTQKLIEKGSFEKQSKARCADIQFQKLKTSSA
FT                   NITDLFYLQNADRTVEIFRVRSSDEIKKGITKRTKRLKEKGYDEDEILQSLKESEISMM
FT                   ITPFTTLRTISKVKSCTWVNNDKNSKKLDLLVSLTNNSIEYHNIPIPESIKKTQASDIY
FT                   SVKQHSVDLLGHRTDIRAMDIAADNKLLATASNGELKIWNIKTQNVIRTFALEGGYALC
FT                   CKFLPGGTLIAIGFKNGDLELYDLATSSVVDRIEKAHDSKSAVDDENGSAIWSLDLTPD
FT                   GKTLVTGGNDKSVKFWNFKVEQEMIPGSNSSVSKLKFVHNQTLELNEDVLCVRISPDSR
FT                   FLAVSLLNNNVQVVFLDSLKLFLTLYGHKLPVLSIDISDDSKLIITSSADKNIKIWGLD
FT                   FGDCHKSIFGHQDSIMNVKFIPDSHNFFSSGKDGLIKYWDGDKFECIQKLPAHQSEVWC
FT                   LAISSDGRFMISTSHDHSIRLWLATDDQVFLEEEREKEMDELYENTLLESLEEDPTHNN
FT                   NEEDDEKEDGEEVSKVTKQTMETLKAGEKLMEALDIGTEDVLATEDYESHLKNFQAKRI
FT                   AAPPVKPTPNPILLALGINGQEHVLNTVTKIRPAQLDDALLVLPFSYSLKLLKFIEIWT
FT                   NKQNVTNNVVNISLICKILFFVIRSNAKEFIHQKSPELKNQLATVKKQLREELSKTSNQ
FT                   LGYNIQGLKFTKQQWKLTHESEFIDEAEQREYEDKKAIKRSFTTI"
     atggttaaat catatgatcg ttatgaacaa gaaaaatgct ttggtgtaat tgcgtcacag        60
     tcgaacattg tatatcttcc acctactctg aatcaatcat caaaaaccat tggaagagct       120
     atttcatcag gattagagga aattttggtt tgggatatta agacaggtga agtactcaac       180
     agattgagag atggtttaac accaggtgct tcaaatgcac caactgctca agcaccatca       240
     ccggtctcat atttagcata tcatgaagac acgaacattg tcgctgcagg atacttagat       300
     ggatcgatca agatatggga tttgacatca ggctcagcat taatcagctt tcaaggtcac       360
     aagtcttcaa ttagtatttt aaaatttgac agaagtggta ctaggttgtt gtctgggtcg       420
     aatgatgcca cgattatttt atgggacttg gttggagaag aaggattatt caaattaaaa       480
     ggtcacaaga gtcaaatcac cggtttaaac tttcttaccg agaatcctga atcaaaaggg       540
     tctgatgacc ttgaagatta cttgttgagt gtttctaaag acggattgat taaattgtgg       600
     gaagtaaaga cacagcaatg tgtagaaact catttagctc attccaatga atgctggtct       660
     ttaggaatga atacttcaaa taacgtagcc ataactaccg gaaacaagga tcaagttaaa       720
     gtctgggaaa ttgacctttc tcaaccagat actcaaaaat taattgaaaa aggatcattc       780
     gagaaacaaa gtaaggcgag atgcgctgat attcaatttc aaaagttgaa aacatcaagc       840
     gctaacataa cagacttatt ttatttacag aatgcagata gaactgtgga aatatttaga       900
     gtaaggtcct ctgatgaaat aaagaagggt attactaaga gaacgaagag actcaaagaa       960
     aagggatatg acgaggacga aattttacaa tcattgaaag aatctgaaat aagtatgatg      1020
     atcactccat ttactacttt aagaaccatt tccaaggtga agtcatgcac atgggttaat      1080
     aatgataaga atagtaaaaa gttggacttg cttgtttctt tgactaataa ctctattgaa      1140
     taccataaca ttccaattcc cgaactgata aagaaaactc aagcatccga tatatattcc      1200
     gtgaaacaac attcagttga cttgttaggt catagaactg atataagagc aatggatatt      1260
     gctgccgata ataaattgtt ggctactgca tcgaatgggg aattaaaaat ttggaatatt      1320
     aagacccaga atgttattcg tacatttgca ttagaaggag gttacgcttt gtgttgtaag      1380
     tttttgccag gagggacatt gattgcaatt ggttttaaaa atggggattt agagttatac      1440
     gatttagcta cgtcatctgt agtggacaga attgaaaaag ctcatgattc aaagtcagct      1500
     gttgatgatg aaaatggatc ggccatatgg tcgttggatt taactccaga tgggaagaca      1560
     ttagttaccg gtggtaatga taaatctgta aagttttgga acttcaaagt tgaacaagaa      1620
     atgattccag gttccaattc atctgtgtcg aaattaaaat tcgtacataa tcaaactttg      1680
     gaattaaatg aagatgtgtt atgtgtgaga atttctccag attcaagatt tttagccgtt      1740
     tctttattga ataataatgt gcaagttgtt ttccttgatt cgttgaaatt attcttaaca      1800
     ttgtatggtc ataaattacc ggttttgtca attgacattt ctgatgactc caagttgatt      1860
     atcacttcat ctgctgataa gaacattaag atttggggtt tggatttcgg tgattgtcat      1920
     aagtctattt ttggtcacca agattcgatt atgaatgtta agttcattcc agatagtcac      1980
     aactttttct cttctggtaa ggatggtctt atcaaatatt gggacggtga taaattcgaa      2040
     tgtattcaaa agttaccagc gcaccaatct gaagtttggt gtttagctat tagtagtgat      2100
     ggaagattta tgatttccac ctcccatgat cattcgataa gattgtggct tgctactgat      2160
     gaccaggttt tcttggaaga agaaagagaa aaggaaatgg acgaacttta tgaaaacaca      2220
     ttattagaat cgttggaaga agatccaact cacaataaca acgaggaaga cgatgaaaaa      2280
     gaagacggag aagaagtatc aaaagttacc aagcaaacta tggaaacttt gaaagctggt      2340
     gaaaagttaa tggaagcatt ggatatcggt accgaagatg ttttagcgac ggaagactac      2400
     gaactgcact tgaaaaactt ccaagctaaa agaattgctg ctccaccagt caaacctact      2460
     ccaaacccaa tcttgttggc tttaggcatt aatggccaag aacatgtttt aaataccgtc      2520
     accaaaatca gaccagctca attggacgat gctttactag tgcttccatt ttcctactcc      2580
     ttgaagttgt tgaagttcat cgaaatctgg accaacaaac aaaacgttac aaacaatgtt      2640
     gtcaatatct cactcatctg taaaatattg ttcttcgtca tcaggtcaaa tgccaaagag      2700
     tttattcacc aaaagagtcc tgagctcaaa aaccagcttg caaccgtcaa aaaacagctc      2760
     cgtgaagaat tgtctaaaac ctcaaaccaa ctaggataca acatacaagg tttgaagttt      2820
     acaaaacaac aatggaaact tactcacgaa tcagaattta ttgacgaggc tgaacaaagg      2880
     gaatacgaag acaagaaggc tattaagaga tcctttacaa ctatataa                   2928
//

If you have problems or comments...

PBIL Back to PBIL home page