(data stored in ACNUC6288 zone)

EMBL: CR382138.PE195

CR382138.PE195       Location/Qualifiers
FT   CDS_pept        408615..409439
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04488g"
FT                   /old_locus_tag="DEHA0F04917g"
FT                   /old_locus_tag="DEHA-IPF8711"
FT                   /old_locus_tag="DEHA-CDS4530.1"
FT                   /product="DEHA2F04488p"
FT                   /note="some similarities with uniprot|P28817 Saccharomyces
FT                   cerevisiae YDR036C EHD3 Protein of unconfirmed function
FT                   plays an indirect role in endocytic membrane trafficking
FT                   member of a family of enoyl-CoA hydratase/isomerases and
FT                   similar to CA5879|IPF12076 Candida albicans IPF12076"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88879"
FT                   /db_xref="GOA:Q6BML0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BML0"
FT                   /protein_id="CAG88879.2"
FT                   /translation="MSEFNLEDYKKYDKFIVSEVEEGFYHVQFNNPKSLNAFTEQVWRD
FT                   YAEILERLDKCEETSVILISSAIPKAFSSGLDLKDAIKTMSSTVSNSEKERYDSLHQHI
FT                   VDFQYCIAAPARIRTPTICLMNGINYGLALDISSACSIRVATADCKFSIREIKIGIPAD
FT                   IGSLQRMPTIVNNKSLMYQYALTGGVFGADEATKLGFVSAVLPDLNAGVEYCKNLGENI
FT                   NQHQQWAIKGTKESIQSIVDNGSPSEGLKNIAHYNATHIDGRFVRAMSGIKL"
     atgagtgaat tcaatttaga agactacaaa aagtatgata aatttattgt tagtgaagta        60
     gaagaaggat tctatcatgt acaattcaac aatccgaaat ccttaaatgc atttacagaa       120
     caagtttgga gagactatgc agaaatatta gaaaggttag ataaatgtga ggaaactagt       180
     gtgattttga tctcatccgc aattcccaag gcattttcca gtgggttaga tttaaaggat       240
     gcaattaaaa ctatgtcaag tactgtactg aattctgaaa aggaaagata tgattcttta       300
     catcaacaca ttgttgattt tcaatattgc attgctgccc ctgctcgtat cagaactcct       360
     acgatttgct taatgaatgg aatcaattac gggttggctt tggacatttc ttcagcatgt       420
     tccattagag tcgcgactgc tgattgcaag ttctctatac gagaaatcaa gattgggatc       480
     ccagccgata ttggttcttt acaaagaatg ccaactatag tcaacaacaa gtcattgatg       540
     taccaatatg ctttgaccgg tggtgttttt ggcgctgatg aagccaccaa attgggtttt       600
     gttagtgctg tccttccaga tctaaacgca ggagttgaat attgtaaaaa cttaggtgaa       660
     aatattaatc aacatcaaca atgggctatc aagggaacca aggaaagtat tcaatctatt       720
     gttgataatg gttcaccttc cgaaggattg aagaacatag cacattataa tgctactcat       780
     attgacggta gatttgtcag agcaatgtcg ggtattaaac tctag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page