(data stored in ACNUC6288 zone)

EMBL: CR382138.PE203

CR382138.PE203       Location/Qualifiers
FT   CDS_pept        complement(420860..422437)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04664g"
FT                   /old_locus_tag="IPF_8699"
FT                   /product="DEHA2F04664p"
FT                   /note="weakly similar to uniprot|Q03761 Saccharomyces
FT                   cerevisiae YDR145W TAF12 Subunit (61/68 kDa) of TFIID and
FT                   SAGA complexes involved in RNA polymerase II transcription
FT                   initiation and in chromatin modification and similar to
FT                   CA1622|IPF10045 Candida albicans IPF10045"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66274"
FT                   /db_xref="GOA:B5RU96"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR037794"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU96"
FT                   /protein_id="CAR66274.1"
FT                   /translation="MNNNNSGENMNTSGNPDSGASTPNLQNRQMAQRPVSIQPSQVNQL
FT                   AQALRNEVSLAKAAGNDIAKAQQHYAKAESIKQVLLNYRDQQNARKAQQQQQQQQQPVG
FT                   TSNQVNQPASAGITPINRQSSPQPTPQGQSPVLNQSQPIHQSPTNSASPVPSIPANSNN
FT                   NNAATIEKFNQAKARLGEFERKIQQLQNSKKSYNLNPEQVTSIESQLTELKSKYAQYQR
FT                   YAIYIKSQLVEQAKSNITSAPGMSNAPTPGTVANQRVPSIGNSAPQGISSPSMPKQGSL
FT                   PPDVGNLSNKQASVSAKGKSVSPPPTNVNATPSKSGPGSQSSSHGVPPINLSGITKPSV
FT                   PSIPISSSINVKPPTAVTLKPTSNNNRATLSSGVANGIGQILGTPAILKLPTYDLSSSG
FT                   AGGAIPDNGGRVLTKRKLSELVNNIGADEGDGKTNIDGDVEELLLDLADEFITSVTGFA
FT                   CRLAKHRKVDSVDVRDVQLHLERNWNIRIPGYAMDEIRTTRKWQPNPSYNQKVSGVEIS
FT                   KSVNGNIN"
     atgaataaca ataatagtgg tgagaacatg aatacgtctg gaaatccaga ttctggtgcc        60
     tctacaccaa atcttcagaa tagacaaatg gctcaaaggc ctgtctcaat ccaacctagt       120
     caagtgaatc aattagcgca agcgttaaga aatgaagtta gtctagcaaa agcggcggga       180
     aatgatattg ctaaggcgca gcaacattac gccaaagcgg aatccattaa acaagtgtta       240
     ttaaattata gagatcaaca aaatgcaagg aaagcacagc aacagcaaca gcaacaacaa       300
     caacctgtag ggacatcaaa ccaggttaat caaccagcaa gtgcaggtat aactcctatt       360
     aacagacaat catctccaca accaacccca caaggacaat ctccagtgct taaccaatct       420
     cagccaatac accaatcccc aacaaattca gcttcgccgg tacctagcat tccagcgaac       480
     agcaataata ataatgcagc tacgatcgag aaatttaacc aagcgaaagc acgcttgggt       540
     gagtttgaaa ggaaaattca gcagcttcaa aatagtaaga agtcttataa tttaaatccc       600
     gagcaagtaa cgtctataga aagccaatta actgaattga aaagcaaata tgcgcaatat       660
     caaagatatg ctatatatat taagtctcaa ttagttgaac aggctaagtc aaatattaca       720
     agtgctccag ggatgagtaa tgcgccaacg cctggtactg ttgccaatca aagagttcca       780
     ctgataggaa atagtgctcc gcaaggcata agttctccat ctatgcctaa acaaggctct       840
     ctccctccgg acgtcggtaa cttgtcaaac aaacaagcat cagtttcagc caagggtaag       900
     tctgtatcac caccaccaac taacgtaaat gccacgccta gcaagtctgg acctggtctg       960
     caatcttctt ctcatggggt gccgccaatt aacttatcag gaattacaaa gccaagcgtt      1020
     ccgtcgattc ctatttctag ttccataaat gtaaagcctc caactgccgt gacgttgaaa      1080
     ccaacaagca acaataatag agccacctta tccagtggtg ttgctaatgg tataggccaa      1140
     attttaggga ctcctgctat attaaaattg ccaacgtacg atctttctag ctctggtgca      1200
     ggtggcgcta tcccggataa tggtggtagg gtcttaacta agaggaaatt atctgaacta      1260
     gtcaataata taggggctga tgaaggtgat ggtaagacca atattgatgg tgatgttgaa      1320
     gaacttttac ttgatcttgc tgacgaattt ataacttccg ttacggggtt tgcttgtaga      1380
     ctagcaaaac accgtaaagt agattctgtt gatgtcagag acgttcagtt acatttagaa      1440
     agaaattgga atattagaat tccaggatac gcaatggatg aaattagaac tacaaggaaa      1500
     tggcaaccaa atcctagtta taatcaaaaa gtttctggag ttgaaatatc taaatcagta      1560
     aatggaaata ttaattag                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page