(data stored in ACNUC6288 zone)

EMBL: CR382138.PE21

CR382138.PE21        Location/Qualifiers
FT   CDS_pept        complement(56616..57611)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00594g"
FT                   /product="DEHA2F00594p"
FT                   /note="weakly similar to uniprot|Q7S675 Neurospora crassa
FT                   NCU07100 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66253"
FT                   /db_xref="GOA:B5RU76"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU76"
FT                   /protein_id="CAR66253.1"
FT                   /translation="MGHACGHNLIATGAIAAAIASSEAMRKFNFAGTIKLFGTPAEEGG
FT                   DGKGKMLKAGAYNDVDVSLMHHGNSESPGQAFVRTAASFRFNIEYFGKSAHAGACPWQG
FT                   VNALDAASIFMHSSSLLRQQFEATDRIHFVVTDGGAAANIIPDYTRIKGIIRAINRGKM
FT                   AELKEKLVGCIKAGALGSGCAYKINYENEYNDMVSNIPLTDSFREFFNGFCDNDNEPKL
FT                   KDLDHERILVSSASTDQGNVSWEIPSLHSFFCIKADKEPHTIEFCEAAGKKSSHDSCLK
FT                   SAKCMSLTGLKVLYDEEFYTKIYSSWKADVESLKPKSVDLNALDNEFTYS"
     atgggacatg cttgcggcca caatcttata gctactggtg caattgctgc agcaatcgct        60
     tcatctgagg caatgagaaa attcaacttt gcaggaacaa ttaaactctt cggcacacca       120
     gctgaagaag gtggtgatgg taaagggaaa atgttaaaag caggtgcata taacgacgtt       180
     gacgtttctt taatgcatca tggcaattct gaaagtccgg gacaggcctt tgtacgtact       240
     gcagcatcat ttagatttaa tatagagtat ttcggaaaga gtgctcacgc tggtgcatgc       300
     ccatggcagg gagttaatgc tttagacgca gcatctattt ttatgcactc ttcttcttta       360
     ttaagacaac aatttgaagc aactgataga attcattttg ttgtgactga tggtggcgct       420
     gctgcaaata ttattccaga ctataccagg attaaaggta tcattagagc aatcaataga       480
     ggtaaaatgg ccgaactcaa agaaaaactt gttggttgta ttaaagctgg tgctttagga       540
     tcaggatgtg catataaaat aaactatgag aatgagtata acgatatggt ttcaaatata       600
     cctttaacag actcttttcg ggaatttttt aatggatttt gcgacaacga taatgaaccc       660
     aaattgaaag acttagatca cgaaagaatc cttgtaagct cagcttcaac cgatcaaggg       720
     aatgtgtcat gggaaattcc atctctccat tctttttttt gcatcaaggc agataaggaa       780
     cctcacacta ttgaattctg tgaagcagca ggtaagaaat cgtcccatga ttcttgtcta       840
     aagtcagcta aatgtatgtc tttgactgga ttaaaagttt tgtatgatga agaattttat       900
     acaaaaattt attcgtcttg gaaagcagat gtcgagagtt tgaaacctaa aagtgtagat       960
     ttaaatgctt tagataatga attcacatat agttaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page