(data stored in ACNUC6288 zone)

EMBL: CR382138.PE211

CR382138.PE211       Location/Qualifiers
FT   CDS_pept        438725..439336
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04862g"
FT                   /old_locus_tag="DEHA0F05324g"
FT                   /old_locus_tag="DEHA-IPF8683"
FT                   /old_locus_tag="DEHA-CDS5327.1"
FT                   /product="DEHA2F04862p"
FT                   /note="some similarities with uniprot|Q12425 Saccharomyces
FT                   cerevisiae YPR067W ISA2 Protein required for maturation of
FT                   mitochondrial and cytosolic Fe/S proteins localizes to the
FT                   mitochondrial intermembrane space overexpression of ISA2
FT                   suppresses grx5 mutations and similar to CA5895|CaISA2
FT                   Candida albicans CaISA2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88898"
FT                   /db_xref="GOA:Q6BMJ7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ7"
FT                   /protein_id="CAG88898.2"
FT                   /translation="MTYLTYRHGYSTETGTKSNTAPKAFKSSSFNQPKEIPKASTSQTQ
FT                   TAEVPQEDIDDFNITKLIHGTTDMKIAITKRASNKLTSIAEDDKNPNAALKVEVESGGC
FT                   HGFQYNLKLTDLTEELKDENNELLVFKRMGDDGEVAQVVLDDSSLQILQDSKVDYTKEL
FT                   IGSQFKIVDSPYTSTACGCGASFDFDFEKLEKVREREANK"
     atgacgtact taacttacag acacggatat tcaaccgaaa caggtacaaa atcaaataca        60
     gcacctaaag catttaaatc ctcgtcgttc aatcaaccaa aagagatccc taaggcatca       120
     acgagtcaaa cgcaaactgc tgaagtaccc caagaagata ttgatgattt taacataacg       180
     aagttgatcc atggaactac ggacatgaag atcgcaataa ctaagagggc cagtaataaa       240
     ctaacgagta ttgctgaaga cgataagaat cctaatgctg cgttaaaagt tgaggtcgaa       300
     agtggtgggt gtcatggatt tcaatacaat ttaaagttga ctgacttgac tgaagaattg       360
     aaagatgaga acaatgagct tttggttttc aaaagaatgg gtgatgatgg cgaggtagcg       420
     caagttgtat tagatgattc ttcattacag attcttcaag actcgaaagt tgactataca       480
     aaagaattaa ttggtagtca gttcaaaatt gttgactcac cgtacacttc tacggcttgt       540
     ggttgtggtg catcctttga ttttgatttt gaaaagttag aaaaagtaag ggagagagaa       600
     gctaataagt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page