(data stored in ACNUC6288 zone)

EMBL: CR382138.PE215

CR382138.PE215       Location/Qualifiers
FT   CDS_pept        join(447286..447307,447425..451713)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04972g"
FT                   /product="DEHA2F04972p"
FT                   /note="similar to uniprot|P47169 Saccharomyces cerevisiae
FT                   YJR137C ECM17 Sulfite reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66276"
FT                   /db_xref="GOA:B5RU98"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU98"
FT                   /protein_id="CAR66276.1"
FT                   /translation="MGSQIEAISNIVKNIEGSVFVTQPAKSVESSFSKYLPNANTLIDS
FT                   NDPYSVINNYAEHRTEGEEQDDEIITVITNGSTIFRNLPFLSSTAFKTSKIVSHVELVN
FT                   FDFSIVSTLRDLNVPVLVSQSTNESVVFSKLSYNLSQRFGQPVFHFFAPSNYRSALSEK
FT                   VDGKIIIDDLSKYEFNDLLSKFGVSPFEVVTGSSKAQHSIVYFGQLNDELISAAKNENV
FT                   VLVSIKVYKPFDLQKLLTIIPSSVETITFVSQTTSPSTSFAPLLLDFFQEYSKYQTLKN
FT                   FTKVAAAFFGYIKSEKYSEIIGNLLSNIKSESPVQNLSFGKTNTELATKASKERHGESL
FT                   KAITNVHNLEQAYLKILQQVNTDSLNILNEFNADNIGVETNPEYGYGAYLNFEEQQKQL
FT                   TDLVYAAIQDNLFKSIDNEKLIDNLSKWLINVRENIETTSNSVLETIKLLETDTNSSNA
FT                   AKILDLKEYFKVNKNWLIGSDAWSYDLGSSGVHNLITSNKNINMLIIDSEPYEDKSNDK
FT                   TVNGFRKKDVGLYAMNYGGCYVASVAIYSSYTQVLQAFIEAEKFNGPAIVLAYLPYHNE
FT                   FDNTLSILKETKLAVDSGYWPLYRYDPTIEDESKSFILDSSNLRNQLKNFLDRENKLTL
FT                   LAKKDPLLSRNLTSNATTEIKAKQLQAANDSYSKLLQGLSGPPLTVAFASDGGNAEAVA
FT                   KKINRQALGRGLKSIVLAMDDISMEDLPNETNIVFIASTSGQGEFPTNGKQFWDGLKNS
FT                   NDIDLSTIKFSVFGLGDSEYWPRKEDKHYYNKPSKDLFNKLKFYGGVELIDIGLGDDQD
FT                   ADGFNTGLNEWEPKLWKALGVDNVEGVEEPKPLTNEDMKIQSDYLRGTIVEGLNDQSTG
FT                   AISAVDQQLTKFHGIYMQDDRDIRDDRKSKGMEPAYAFMVRVRLPGGIATPSQYLRMDE
FT                   LSNERGNGTLKLTTRATFQLHGVVKHDLKPAIRGMNAALMDTLAACGDVNRNVMVSALP
FT                   HNAKVHSQISKTGALISEYLLPQTTAYHEIWLQGEDEGDKAGASKNWENRKEGPKKEKT
FT                   LVAGNALTDFEPMYGPTYLPRKFKVVITVPPYNDVDVYAHDIGLIAIVEGDEVIGYNVL
FT                   AGGGMGSTHNNKKTYPRTGSMFGYIAKDQIHIACEKIMLVQRDFGDRTNRKHARLKYTI
FT                   DDLGVEVFKGKVEELLGFKFEKAKPFEIKSNVDYFGWCKDETGANHFTAFIENGRIEDT
FT                   PELPQKTGLSKIAEYLLQNERPGEFRLTGNQHILISNINDDDLDTVKSLLAQYKLDNTD
FT                   FSGLRLSSAACVAFPTCGLAMAESERYLPELITKLEEALEDYGLRHDSVVMRMTGCPNG
FT                   CARPWVAEVALVGKAFGAYNLMLGGGHHGERLNKIYRYSIKEDEILSILKPLFKRWSLE
FT                   RNEGEPFGDFCIRIGIIKPTTEGKFFHDDLPEDA"
     atgggaagtc aaatagaggc catctccaat attgtcaaga atattgaagg ttcagtattt        60
     gtgactcaac cagctaagtc tgttgaatcg tctttttcga agtatttacc aaatgcaaat       120
     actttgatag actccaacga tccatatagt gtcataaata actatgcgga gcataggaca       180
     gaaggggaag aacaggatga tgaaataatc accgttatca ccaacggctc tactattttc       240
     agaaacttgc catttttgtc gtcaacagct ttcaagacaa gtaagattgt atcacatgtt       300
     gaattagtga attttgattt ttcgattgtt tctacattga gagacttgaa cgttcctgtt       360
     ttggtatcac agtctacaaa cgagtctgtt gtgttttcta aattgagtta caatttaagt       420
     caaagatttg gtcaaccagt tttccatttc tttgcacctt ctaactatcg ttctgcttta       480
     agcgaaaagg tagatggtaa gataatcatt gatgatttat ctaagtatga gttcaatgat       540
     cttttatcca agtttggtgt atctcctttt gaagttgtta caggtagttc caaggcccag       600
     cattctattg tttatttcgg tcaattaaat gatgaactta tcagtgctgc taagaacgag       660
     aatgtcgtat tagtttcaat taaagtttat aagcctttcg acttgcaaaa gttattgact       720
     ataataccat catcggttga aacgattaca ttcgtttccc agaccacctc cccatcaacg       780
     tcgtttgctc ctttattatt agatttcttc caagagtatt ccaagtatca aactttgaag       840
     aatttcacaa aagtggctgc tgcattcttt ggctacataa agtcggaaaa atattcagaa       900
     attattggta accttttatc gaacataaaa tctgaatctc ctgttcaaaa cttgtcattc       960
     ggtaaaacaa atacggaatt ggccactaag gctagtaagg aaagacatgg tgaatctctt      1020
     aaggctatca ccaatgtcca taatttggaa caagcttatt taaagatttt acaacaagtc      1080
     aacactgata gtttgaacat tttgaatgag tttaatgccg ataatatcgg cgtcgaaact      1140
     aatcctgaat atggttatgg tgcgtactta aacttcgaag aacaacaaaa gcaattgaca      1200
     gatttggttt atgcagctat tcaagataat ttatttaaat caattgacaa cgaaaaattg      1260
     attgacaatt tatctaagtg gttaattaac gtgagagaaa acattgaaac taccagtaac      1320
     tcagtattag agactataaa attattagaa acagacacga attcttctaa tgcagccaag      1380
     attctagact tgaaggaata tttcaaagtg aacaaaaact ggttgatagg ttcggacgca      1440
     tggtcgtacg atttagggtc atcaggtgtc cacaatttaa tcacatcgaa taaaaacatt      1500
     aatatgttaa ttatcgattc tgagccatac gaagataaat caaatgataa aactgttaat      1560
     ggattccgta agaaagatgt tggtttatat gcaatgaact atggtgggtg ttatgttgca      1620
     tctgtcgcaa tttattcttc ttatacccaa gtattgcaag cttttataga ggctgaaaaa      1680
     ttcaatggtc ctgctattgt tcttgcttat ttaccatacc ataatgaatt tgataatact      1740
     ttatcaattt taaaggaaac taagcttgca gtagatagtg gatactggcc attatacaga      1800
     tacgacccaa ctatcgaaga tgaatcaaaa tcatttatat tagattcctc gaacttaaga      1860
     aatcaattga agaatttctt ggatcgtgaa aataaattga ctttattagc caagaaagat      1920
     cctttgttgt ctagaaactt gactagtaat gccactactg aaattaaggc taagcaactc      1980
     caggctgcta atgactccta tagtaagtta ttgcaaggat tgtctggtcc tcctttaact      2040
     gttgctttcg catccgatgg gggtaatgca gaagcagttg ccaaaaagat caatagacaa      2100
     gctcttggaa gaggattgaa atcaattgtt ttagcaatgg atgatatatc aatggaagat      2160
     ttaccaaatg agacaaatat tgtatttatt gcttctactt cgggacaagg tgaattccca      2220
     actaacggta aacaattttg ggacggttta aagaattcta acgatatcga cttgtcaacc      2280
     atcaaattct ctgtttttgg tttaggtgat tctgaatact ggccaagaaa agaagacaag      2340
     cattattaca acaagccaag taaagattta ttcaataagt tgaagttcta cggtggtgtt      2400
     gaattaatcg atattggttt aggtgatgat caggatgcag atggattcaa tactggtttg      2460
     aatgaatggg aaccaaaatt atggaaagct ttaggggtgg ataatgttga aggtgttgaa      2520
     gaaccaaagc ctttgactaa tgaggatatg aaaattcaat ctgattactt aagaggtact      2580
     attgttgaag gtttgaacga tcaatctacg ggagctataa gtgctgttga ccaacaatta      2640
     actaagttcc atggtattta tatgcaagac gatcgtgata tcagagatga ccgtaagagt      2700
     aaaggtatgg aaccagcata tgcctttatg gttagagtta gattaccagg tggtatcgct      2760
     actccatctc aatacttgag gatggatgag ttatcgaatg aaagaggtaa tggtacttta      2820
     aaattaacta cgagagctac ctttcaactt catggtgttg ttaaacatga cttgaagccg      2880
     gctattaggg gtatgaatgc agcattaatg gatacgttgg cggcttgtgg tgatgtcaac      2940
     agaaatgtca tggtttctgc tttacctcat aatgcaaagg ttcattctca aatttccaaa      3000
     actggtgcat taatatccga gtatttattg cctcaaacta cggcttatca tgaaatttgg      3060
     ttacaaggtg aagatgaagg cgataaggca ggagcatcga agaactggga aaaccgtaag      3120
     gaaggaccaa agaaggaaaa gactttagtc gcaggtaatg cattgactga tttcgaacct      3180
     atgtacggtc caacttattt accaagaaag tttaaggttg ttattactgt tccgccatat      3240
     aatgatgtcg atgtctatgc ccatgatatc ggtttgattg ctatcgtcga gggcgacgaa      3300
     gttattggct acaatgtttt agctggtggt ggtatgggtt ctactcataa taataagaag      3360
     acttatccaa gaactggatc tatgtttggt tacattgcaa aggatcagat tcacattgca      3420
     tgtgaaaaga tcatgttagt tcaaagagat tttggtgata gaacaaatag aaagcatgct      3480
     agattgaagt atactattga tgatttgggt gtagaggtct tcaagggtaa ggtggaagag      3540
     ttattaggtt tcaaatttga aaaagctaaa ccatttgaaa taaaatccaa tgtcgattat      3600
     ttcggatggt gtaaggatga aactggtgct aatcatttta ctgcttttat tgaaaatggt      3660
     agaattgaag acacacctga attaccacaa aagaccggtt tgagtaaaat cgcagaatac      3720
     ttgttacaaa acgaaagacc cggtgaattt agattgacag gtaaccagca tattttgatt      3780
     tctaacataa acgatgatga tttggatact gtaaaatcat tgttagctca atacaagttg      3840
     gataacacag atttctctgg tttaaggttg tcttctgcag cttgtgttgc attcccaact      3900
     tgtggtttag ctatggcaga atcagaacgt tatttacctg aattaattac aaagttagag      3960
     gaagctttag aagattatgg tttaagacac gattcggttg ttatgagaat gaccggttgt      4020
     ccaaatggtt gtgcaagacc atgggttgca gaagtcgcat tagtcggtaa agcatttggt      4080
     gcgtataact taatgttggg tggtggtcac catggtgaaa gattaaataa gatttacaga      4140
     tattccataa aggaagatga aattttaagt atccttaaac cattgttcaa gagatggagt      4200
     ttagaaagaa atgaaggaga accattcggt gatttctgta ttagaattgg tattattaag      4260
     ccaactactg aaggtaaatt cttccatgat gatcttcctg aagatgctta g               4311
//

If you have problems or comments...

PBIL Back to PBIL home page