(data stored in ACNUC6288 zone)

EMBL: CR382138.PE226

CR382138.PE226       Location/Qualifiers
FT   CDS_pept        join(467966..468018,468073..468928)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05236g"
FT                   /old_locus_tag="DEHA0F05742g"
FT                   /product="DEHA2F05236p"
FT                   /note="weakly similar to uniprot|Q9P7V3 Schizosaccharomyces
FT                   pombe SPAC30.03c Translin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88913"
FT                   /db_xref="GOA:Q6BMI3"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR016069"
FT                   /db_xref="InterPro:IPR033956"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI3"
FT                   /protein_id="CAG88913.2"
FT                   /translation="MSKLQGLFGLFQEEINTEINFKNKINDLENLFNAELAIIKSEYAN
FT                   LSTIQPSNLPYDFSSEDITSVPFVFALRELCQEKIINNENRDITELGTVNEVKVIDNLN
FT                   LLSDRYHRYLQELNGINCKAIFKDRFSHKINEEIIYVLMANRYFKTISYIYQVDLKGKQ
FT                   LDKILHPLISKSDQDIMGLVITPEEIQRVLSLEKLNYNDYLLGLLRLIETVVEYTIDTI
FT                   ISISISSENSPKQLQNIQYSLSLINLQIVTKLQNGFQMLDLKNDNIRRKFDGLKYNFKK
FT                   MNGIVYDLSLRKLIVNEVEIY"
     atgtcgaaat tacaaggttt atttggttta ttccaagaag aaatcaatac ggaaattaat        60
     tttaagaata aaattaatga tttagaaaac ctattcaatg ctgaacttgc aattataaaa       120
     tctgaatatg ccaatttgtc tactattcag cctagtaatc taccttacga cttctcttcg       180
     gaagatataa caagtgtacc gtttgtcttt gcgttgagag aattgtgtca agaaaagata       240
     ataaataacg aaaacagaga tatcacagaa cttggaactg ttaatgaagt caaggttatt       300
     gataatttaa atctactaag cgatagatac caccgttatt tacaagaatt aaatggaatt       360
     aattgcaaag ctatcttcaa ggacaggttt tctcataaaa ttaacgaaga aatcatttat       420
     gtattaatgg ctaatcgcta tttcaagaca atatcatata tttatcaagt ggaccttaag       480
     gggaaacaat tagataaaat attacaccct ctcatttcaa agagcgatca agatataatg       540
     ggtctagtga taacaccaga agaaatccaa cgcgtattat ctttagagaa attgaattat       600
     aatgactatc tacttggttt attacgcctt attgaaaccg ttgtggagta tacaattgat       660
     acaattatac tgatttcaat atcttccgaa aactccccaa aacaattgca aaatatacag       720
     tatagtttaa gtctcattaa tctacaaatt gttaccaagc ttcaaaatgg atttcaaatg       780
     ctagacttga agaacgacaa tattaggaga aagtttgacg gcttaaaata taattttaag       840
     aagatgaatg gaatagtata tgacttgtcc ttaagaaagc ttattgtaaa cgaagttgaa       900
     atatattag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page