(data stored in ACNUC6288 zone)

EMBL: CR382138.PE232

CR382138.PE232       Location/Qualifiers
FT   CDS_pept        483586..484647
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05368g"
FT                   /old_locus_tag="DEHA0F05874g"
FT                   /old_locus_tag="DEHA-IPF8649"
FT                   /old_locus_tag="DEHA-CDS3640.1"
FT                   /product="DEHA2F05368p"
FT                   /note="weakly similar to uniprot|P06843 Saccharomyces
FT                   cerevisiae YER161C SPT2 Protein involved in negative
FT                   regulation of transcription exhibits regulated interactions
FT                   with both histones and SWI-SNF components has similarity to
FT                   mammalian HMG1 proteins and similar to CA4352|IPF3642
FT                   Candida albicans IPF3642 Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88920"
FT                   /db_xref="InterPro:IPR013256"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH6"
FT                   /protein_id="CAG88920.2"
FT                   /translation="MSLSNILQHVKRKGQIIPKTNQSGRDGTPETNRSTEESNNKNQYR
FT                   YSNGETRTVDPVVARLKAARKLERERKEQEAREKKGLAPKKPKSVPRTNTNSSRNNEVK
FT                   NNNGVGRMNNSSIRSGANMCPNVPPSHKPVKKMNFNDLMKKASKIDQSKLSVSIKPKAK
FT                   SPEVRPTTSKHKPSSRASSAPTEGYRNVPKRKEGRPTTSKYSNSDDNKPSARAPLPVRK
FT                   PSTKLEEKLKSSGKTKPSDTRSNRSRSYNDSEDEYSESFIVSDEEEADYGNSNVPDYDR
FT                   DEIWAIFNRGKKRSYYDRYDNDDSGDDMEATGAEIWEEERRSKRNAELEDRKELEEEQR
FT                   LAALKKARKMKQR"
     atgtctctat cgaatatatt gcagcatgtt aaaagaaaag gtcaaattat acctaaaaca        60
     aatcaatctg gtagagatgg gacacctgaa accaacagga gtaccgaaga actgaataat       120
     aaaaatcagt atagatacag caatggggaa actagaactg ttgatcctgt agttgctagg       180
     ttaaaggcag cgcgtaagtt agagagagag agaaaagagc aagaagcaag agaaaagaaa       240
     ggattagcac cgaagaagcc aaaaagtgtc ccgagaacca ataccaatag ctcacgaaac       300
     aatgaggtca agaataacaa cggagtaggt agaatgaaca actccagtat acgctccggt       360
     gctaacatgt gtccaaacgt accaccatcg cataaacctg ttaaaaagat gaattttaat       420
     gatttaatga aaaaagcatc aaaaattgac caaagcaaac tatcagtatc cattaaacca       480
     aaagcaaaat ctcctgaagt tcgtccaaca acttctaaac ataaacctct gtcaagggcc       540
     agctctgcgc ctactgaagg gtacagaaat gtacctaaaa gaaaagaagg tcgccccaca       600
     acttccaagt attctaattc agatgataat aaaccttcag caagggctcc attacctgtt       660
     agaaagccat caacgaaact agaggagaaa ttaaagtctt ctggtaagac aaaacctagt       720
     gatactcgaa gcaatagatc tcgctcctac aacgattccg aagatgaata ctccgaatcg       780
     tttattgtat ctgatgaaga agaagctgat tatgggaatt caaatgtacc agactatgat       840
     agggatgaaa tctgggcaat ttttaataga ggtaagaaaa gatcgtatta tgatagatat       900
     gataatgacg actctgggga tgatatggaa gcaaccggtg cagaaatatg ggaagaagag       960
     aggagatcca agcgcaatgc tgaattagaa gatcgtaaag aacttgaaga agagcaaagg      1020
     ttagcagctt tgaagaaggc taggaaaatg aaacaacgtt aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page