(data stored in ACNUC6288 zone)

EMBL: CR382138.PE237

CR382138.PE237       Location/Qualifiers
FT   CDS_pept        492131..493921
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05478g"
FT                   /old_locus_tag="DEHA0F05984g"
FT                   /old_locus_tag="DEHA-IPF8639"
FT                   /old_locus_tag="DEHA-CDS1647.1"
FT                   /product="DEHA2F05478p"
FT                   /note="weakly similar to uniprot|P38882 Saccharomyces
FT                   cerevisiae YHR196W UTP9 Nucleolar protein component of the
FT                   small subunit (SSU) processome containing the U3 snoRNA
FT                   that is involved in processing of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88925"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH1"
FT                   /protein_id="CAG88925.2"
FT                   /translation="MSDLRRCLDDSNLYFTNIISKNGRNEVQIFPINKKASESIILDSL
FT                   IVKIELQADEIVTSCCWINNSGINNSERAKKRGKRRQSSSESDLDEATSDNKNLAVALE
FT                   NGDILILSPLHNDIIDRISYGHKIISLTPSLIHDSVWGVLEESRSIVEISLAQSKEVKN
FT                   FKFKEDEQIQSAKTIRQTGGSSRSQHILIGSNNLYLVDPSKPKKSLLTTFPQISEASPI
FT                   SIIEQSRLKENLVVVVRENENQIYLYNTSDSAKFSTFKTSTSQIYGVQLIANTDMTEEL
FT                   LMAVTSEGVEVFKIDFDSNHQEQIPTCLIKTNFHDSIDNIIFMDVFLREKQSLIGVWYN
FT                   GNEPKFENINWNFNSAGEIQVSIDYNEKVNGVVDNRIDDIEFPETTKINNLAVNKLYKD
FT                   LVKLLNVSKKTTEEKIIRLCSSNNNDDNIKETIKLFSTSESSSALITKLFEIISKEVAS
FT                   QPSKNSALSVWLKWLLLVHGGFIAKQPDQHDNLKTLQTGLTEGMKLMPRLLGLQGRLQL
FT                   LKSQTQLRDNLNNMSIESDDEEDKESTDIMVNNDDSENITIANGESDDFEEADVASFAI
FT                   DAEADDEDEDKDEEEAEEED"
     atgagtgatc tcagaagatg tttagatgat agcaatttgt atttcaccaa tataatctcg        60
     aagaatggta gaaatgaggt acagatattc cctataaata aaaaggcatc ggaatcaatc       120
     atattggatt cattaattgt caaaatcgaa ttacaggcag atgaaatcgt tacatcatgt       180
     tgttggataa acaattctgg aataaataat tctgaaagag caaagaaaag aggtaaaaga       240
     agacaatcat catcagagtc tgatttagat gaagctacat cagataataa gaatttagca       300
     gttgccttag aaaatggtga tatattgatc ttatcaccac tccacaatga cattatcgat       360
     agaatatcct acgggcataa gatcatcagt ttgactccct cattaattca tgactcggtc       420
     tggggggttt tagaagaaag taggtcaata gttgagattt ctttggcaca aagtaaagag       480
     gtgaagaatt ttaaatttaa ggaagatgaa caaatacaat cagcaaaaac tattaggcag       540
     acaggtgggt cttctagatc tcaacacata ttaataggat ccaataattt atacttagtt       600
     gacccatcaa aacctaaaaa gtcattgttg actacgttcc cacaaatttc tgaagcttcc       660
     cctattagta ttattgaaca atcacgtctc aaagaaaact tggtagttgt ggtaagagaa       720
     aacgagaatc agatttattt gtacaatact tcagattctg ccaaatttag tacttttaaa       780
     acttctacaa gtcaaatata tggtgtacaa ttaattgcaa atactgatat gactgaagaa       840
     cttttaatgg cagtcacatc agaaggtgtt gaagtattca aaattgattt cgattcgaat       900
     caccaagaac aaatcccaac ctgcttaatt aagacaaatt ttcatgattc gatagacaat       960
     ataattttca tggatgtctt tttaagagaa aaacagagtt taattggagt ttggtataat      1020
     ggtaatgagc ctaagttcga gaatattaat tggaatttca actcagcggg tgaaatacaa      1080
     gtttccattg attataacga gaaagtcaat ggcgtggttg ataatagaat agatgatatt      1140
     gaatttcctg agaccactaa aataaataac cttgcggtta ataaattgta taaagacttg      1200
     gttaagttat tgaacgtttc aaagaaaacc acagaagaaa agattattag attatgttca      1260
     tctaacaaca atgatgataa catcaaagaa acgattaagc ttttttctac atctgagtct      1320
     tcatcagctt tgattacaaa attatttgag attatcagca aagaggtcgc atcgcaaccc      1380
     tctaaaaatt ctgcgttgtc tgtttggttg aaatggcttt tgctagtaca tggtggattt      1440
     attgccaaac aaccagatca gcacgacaac cttaaaacat tgcaaacagg attaactgaa      1500
     ggcatgaaat taatgcctcg attattagga ttgcaaggta gattacaatt attgaaatct      1560
     caaacacaat tgagagataa tcttaataac atgagtatcg aatctgatga cgaagaagat      1620
     aaagaactga ccgatattat ggttaataat gatgactcag aaaatatcac tattgcaaat      1680
     ggtgagagtg atgattttga agaagctgat gtagcctcat ttgctattga tgcggaagct      1740
     gatgacgaag acgaagacaa agacgaagaa gaagcagagg aagaagacta a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page