(data stored in ACNUC6288 zone)

EMBL: CR382138.PE240

CR382138.PE240       Location/Qualifiers
FT   CDS_pept        500495..502165
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05566g"
FT                   /old_locus_tag="DEHA0F06072g"
FT                   /old_locus_tag="DEHA-IPF8633"
FT                   /old_locus_tag="DEHA-CDS1916.1"
FT                   /product="DEHA2F05566p"
FT                   /note="weakly similar to uniprot|P50276 Saccharomyces
FT                   cerevisiae YGR055W MUP1 High affinity methionine permease
FT                   integral membrane protein with 13 putative membrane-
FT                   spanning regions"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88928"
FT                   /db_xref="GOA:Q6BMG8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG8"
FT                   /protein_id="CAG88928.2"
FT                   /translation="MAPTLLPKVSIGSSTFSRMPLLERRKYHKLGTLSCMSLIVNKMIG
FT                   TGIFSTPAIIFQYCQGNVGLYLFLWLVGGIIIFSGLVIFLEFALNLPFTNGGEKNYLLR
FT                   VFRKPKGLMGCIYSFQMVLLGFSSGNAFAFGKYVLFAVNGEEIKEEEWSVKIIGVLCIS
FT                   FCIFLHIKFPNQGTSLFNLLGVFKIFILVLIIAIGLLVSVDIIKLPTTVDNFSNLFEST
FT                   TKKDNNYYSISVALLEIIYSFKGWENANYVLSEVSDPYHVLTIAAPSAVVITTILYFLV
FT                   IISYLIVIPKQELLDSGVLVAGIFFNKVFGESITSRILPIIISSSNLGNVMVVSFAHAH
FT                   VNQELARNNYLPFSKYFEDINNSLLLHWFITVIIMVAPPSSEIYEFVVNLYIYPGTWIN
FT                   LLITIGLIYLHLNSRGEKWGKHNTGNGLETNSANNSIYDDNDNLILQLNDDSYTEFDSL
FT                   ISVENDNDTSKFSAPIICIVIFLFSNIFLAVFPFFPPPSDSSSSQSIIPYWCFPVVGTS
FT                   VLLSGVAWFYIRRWFHTWRYDKYKIGEPNVKYEDDYSTN"
     atggcgccaa cattattgcc aaaggtgtcc atagggtcat cgactttttc gagaatgcct        60
     ttgttagaaa gaagaaaata tcataaatta gggacattat catgtatgtc tctaattgtg       120
     aataaaatga taggtacggg gattttcctg acgccagcta taatatttca atactgtcag       180
     gggaacgttg gattatattt gttcttatgg ttggtaggag gaataattat tttcagtgga       240
     ttagtgatat tcttggagtt tgcattaaat ttaccattca caaatggagg agaaaagaac       300
     tacttgttaa gggtgtttcg taaaccgaag ggtctaatgg gatgtattta ttcctttcaa       360
     atggttttac taggattcag ttctggtaat gcttttgctt ttggaaaata tgtattattc       420
     gccgtgaatg gagaggaaat taaagaagag gagtggagtg ttaagatcat aggggtatta       480
     tgtataagtt tttgcatttt tttacatata aagtttccaa atcaaggtac ttcattattt       540
     aatctattag gagtattcaa gatattcata ttggtcctaa ttattgcaat aggtttactt       600
     gtctcggttg atataataaa gttacctacc actgttgata atttctcaaa tttgtttgaa       660
     tctacgacca aaaaagataa taactattat tcaatttcgg tagctctatt agaaatcatc       720
     tattcattta agggttggga aaatgctaat tacgtattac tggaagtctc agatccttac       780
     catgttctta cgattgctgc cccatccgct gttgttataa caacaatttt atactttttg       840
     gttattatat cctatctaat tgtgattcct aaacaagagt tattagatag tggggtgttg       900
     gtagcaggaa tatttttcaa taaggttttt ggcgaaagca tcacatcaag gattttacca       960
     attataattt cttcttctaa ccttggaaat gtaatggtgg tatcatttgc tcatgctcat      1020
     gttaatcaag agcttgcgag aaacaattac ttaccttttt ccaaatattt tgaagatata      1080
     aataattcgt tattattgca ttggtttatt actgttatca ttatggttgc acctccatca      1140
     tcagaaatat atgagtttgt tgttaattta tatatatacc ctggtacatg gatcaacttg      1200
     ttaataacaa ttgggttaat ttatttgcat ttgaatagca gaggtgagaa atggggaaaa      1260
     cacaatactg gaaatggatt agaaaccaat tcagctaata acagtatcta tgatgacaac      1320
     gacaatttaa ttcttcaatt gaatgatgac agctatacag aatttgactc cttaatatca      1380
     gtagaaaatg ataatgatac gtctaagttt tctgctccta ttatatgcat tgttatattt      1440
     ttattctcta acatattttt agcggtgttt ccattcttcc caccaccatc agattcatcg      1500
     tcatctcagc tgataatacc gtactggtgc tttcctgtcg taggtacatc agttttacta      1560
     ctgggtgtag cttggtttta catccgaaga tggttccata cttggagata cgacaaatat      1620
     aaaattggtg aacctaatgt taagtacgag gatgattatt ctacaaatta a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page