(data stored in ACNUC6288 zone)

EMBL: CR382138.PE242

CR382138.PE242       Location/Qualifiers
FT   CDS_pept        complement(503661..505163)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05610g"
FT                   /old_locus_tag="DEHA0F06116g"
FT                   /old_locus_tag="DEHA-IPF8630"
FT                   /old_locus_tag="DEHA-CDS2338.1"
FT                   /product="DEHA2F05610p"
FT                   /note="weakly similar to uniprot|P48581 Saccharomyces
FT                   cerevisiae YOR368W RAD17 Checkpoint protein involved in the
FT                   activation of the DNA damage and meiotic pachytene
FT                   checkpoints"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88930"
FT                   /db_xref="GOA:Q6BMG6"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="InterPro:IPR016587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG6"
FT                   /protein_id="CAG88930.2"
FT                   /translation="MSDESLDFQKSSGTSGNGVSSSPFTFTASTNQVSHLADVFSSITS
FT                   INSQALMIITTNGIIIYSEYNHICNVQLSIDPSLFGTYNFYSENNTSSSQNNEELRLGV
FT                   DISLISDAFIAAASSSVSKSKTKATANNGNTVTANGSVDNQVCYITYNGEGYPLVIEFE
FT                   DSLMSEKIEFLTFYLDMTYPYDVSNSQEEEEEEQYNLVINHSEIQFEVILKSDVFTNLL
FT                   KDLQQINTIDLFMFISNEMRQLGSNRQNSKKSRKSGPLYLDKQFNFISKGPIGHSKLIF
FT                   PNEKTILEKLNIYGMDHDDSEMKPINTSLISCYNFGNFSKIFKAVKLSIKCKIMKDLSG
FT                   ILSIQLLCKNPQLTNYSGTLITFNMLESTTIVDKFDKNEEPEEFERFHLNNIFEDESYE
FT                   YIKDYNDKNPKRVPMPNIESTNIQEYEELGNEKDEPPILSYASFRNNSKSATSNNVQIN
FT                   ETIYEEDKNGNNKKRKKEIESAKDSDKDVKTVGSAIEIPLFL"
     atgtccgatg aatcattaga cttccagaaa tcttcaggaa cttctggaaa tggcgttagt        60
     agttcacctt ttacgtttac tgcatcaaca aatcaagtat cacatttagc agacgtattc       120
     tcatcgataa catcgattaa ttcccaggcg ttgatgataa taacaacaaa tggtataata       180
     atatactccg aatataacca tatatgtaat gtacagttat ctattgatcc atccttattt       240
     gggacttata acttttattc tgaaaataac accagttccc tgcaaaataa tgaagaatta       300
     agactcggtg tcgatataag cttaataagt gatgcattta ttgcagcagc gtcatctagc       360
     gtgtcaaaaa gcaaaacaaa ggctacagca aataatggta atacagtaac agctaatggt       420
     tctgtagata atcaagtgtg ttatataaca tacaacggtg aaggatatcc cttggttata       480
     gaattcgaag atagcttaat gagtgaaaag atagagttct tgacgtttta ccttgatatg       540
     acgtatccct atgatgtatc caacagtcaa gaagaagagg aagaagaaca gtataaccta       600
     gtcattaatc acagtgaaat tcaatttgaa gtaatattga aaagtgacgt atttacgaat       660
     ctacttaaag atttgcagca gataaatact attgacttgt tcatgtttat ttcgaatgaa       720
     atgagacagt taggctcaaa tagacaaaat tcaaagaaaa gccgaaaatc tggtccatta       780
     tatttggata aacaatttaa tttcatatct aaagggccaa ttggtcatct gaaattaata       840
     tttccaaatg agaaaactat actagagaaa ttgaatatat acggtatgga tcatgatgac       900
     tccgaaatga aacctataaa cacttcattg atttcctgtt ataattttgg taatttcagt       960
     aagattttca aagcagtgaa gctttcaatc aaatgcaaaa taatgaaaga tttatctggt      1020
     atattatcta ttcaattact ttgtaaaaat ccacaactaa caaactactc aggtacttta      1080
     ataactttca atatgctaga atccacgaca atcgtcgata aatttgataa gaacgaggaa      1140
     ccagaagaat tcgaaagatt tcacctcaac aacatttttg aagacgagtc atacgaatat      1200
     ataaaggatt acaatgataa aaaccctaaa agggttccta tgcctaatat cgaatctaca      1260
     aatattcaag aatatgaaga acttggcaac gaaaaagatg aaccacctat attatcatat      1320
     gcttcgttcc gtaataattc aaagctggct acgagcaata atgtacaaat taatgaaacg      1380
     atttatgagg aagataagaa tggaaataat aagaagcgca aaaaggaaat agaatccgct      1440
     aaggatagtg ataaggatgt caagaccgtt ggtagcgcta ttgaaattcc actctttttg      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page