(data stored in ACNUC6288 zone)

EMBL: CR382138.PE245

CR382138.PE245       Location/Qualifiers
FT   CDS_pept        complement(508137..511622)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05676g"
FT                   /old_locus_tag="DEHA0F06182g"
FT                   /old_locus_tag="DEHA-IPF8626"
FT                   /old_locus_tag="DEHA-CDS0269.1"
FT                   /product="DEHA2F05676p"
FT                   /note="some similarities with uniprot|Q08562 Saccharomyces
FT                   cerevisiae YOR191W RIS1 Member of the SWI/SNF family of
FT                   DNA-dependent ATPases plays a role in antagonizing
FT                   silencing during mating-type switching contains an N-
FT                   terminal domain that interacts with Sir4p and a C-terminal
FT                   SNF2 domain and similar to CA4382|IPF8576 Candida albicans
FT                   IPF8576"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88933"
FT                   /db_xref="GOA:Q6BMG3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG3"
FT                   /protein_id="CAG88933.2"
FT                   /translation="MASDEPSQNIINLSSDDDEEVDENVSLKDIQINGHEIHERGNNQD
FT                   WRQANSNSNTTHINQPPKRQRLDSLYSNNGPFRSPSKQGNDLSHIGNSNHIQQRQLYPK
FT                   TLPNAVLDRTVFGPRSVSSNTTIQNHPRQSEPQSIPKNNLIQNQYMQADPQSIPNNNTI
FT                   QYQSRQADPQEDVIILSSEDEDMDSDGDIMILDAEEASRIGKFKTSSFERNANRSSRDM
FT                   GNYEAPANTGPYYSVPAVNPNEMHVTYNNPAPVPHFTKDDGPEVEKLNFQRAQETLEEN
FT                   VRRKDELLYKHEQLTSDFTKSSRQANELLQHLTLLQSHLKREEIQENRDENTILSLKNE
FT                   ISFKGAEYHNFRRSKDATATSLSGIASKLSWLTVSIRDAKSRIHNYGKHRNGVNIIDNP
FT                   FVLNNNSGRNNSDYENESIMNNPFGNIPGFSANVYSDNDQQHLQNLLNNIRPDEELDEE
FT                   GLSLTPSELAITLLKHQRMGLAWLLRMEESKSKGGILADDMGLGKTVQTIALIMAHKSD
FT                   DDNRKTNLVIAPVSLLRQWAAEIESKIKPNAQIKIAIYHGSVKKNLRTFNSLKKYDVVL
FT                   TSYGTLSSEWKKHYQGPLEEARLSRNQNVIPDLDAGGTSYTSPFFATDAVFYRIILDEA
FT                   QNIKNKSAIASKASYCIKGIHRFCLSGTPIQNNVEELYPILRFLRIKPYNDESKFRSDI
FT                   VLPIRSKSSGYDDFDKKKSMQKLRALLRAILLRRSKNSLIDGKPILSLPDKLVTEDTVQ
FT                   MEDEELTYYRELEQGIQKKAKTLLASEKLGSTSSILTLLLRLRQACCHSFLVEMGRMKA
FT                   AESEATKTLITRDWKSMYVNIQKFDEDTINRIRNEVHQGNLLKGENEGESNTNSDEDLF
FT                   TCPICYDVLGYESIVLFSGCGHMICNNCIENFFERFETGDGSEGNRLASCFSCSKSIKE
FT                   NELIDYNMFHMIHQEGYDRDKIAEFYNINYSSNGKTTNMQKIRQLIQENKGFTPSAKME
FT                   KCMHLIKDVLENYPDEKIIIFSQFLSLFDLMKLVLANEKIPFLRYDGSMSLDEKNSTIK
FT                   QFYQGSTKVLLISLRAGNVGLTLTCASHVIIMDPFWNPYVEEQAMDRAHRIGQQRDVRV
FT                   HRILTEGSVEGRIMTLQNEKKEIISGALDEKGMKSVSKLGRQELGFLFGLNELR"
     atggcatctg atgagccatc gcagaatata ataaatcttt cttctgatga tgacgaagaa        60
     gtggatgaaa atgtttcact taaggatatt caaattaatg ggcacgaaat acatgaaaga       120
     ggtaataacc aagattggag acaagcgaat agcaacagta acaccacaca cataaatcag       180
     cctcctaagc gacagagact tgactctttg tacctgaata acggcccgtt tagatcgccg       240
     tcaaaacaag gcaatgattt aagccatatt ggtaattcaa accatattca acaacgccag       300
     ttatatccta agacacttcc aaatgccgta ttggaccgga cagtatttgg accacggtca       360
     gtgctgagca atactactat ccaaaaccat cccaggcaat cagagcctca atcaataccg       420
     aagaataatt taatccaaaa ccaatacatg caagcagatc cacaatctat tcctaacaat       480
     aatacaattc aataccaatc caggcaagca gatccacaag aggatgtaat cattctcagt       540
     agcgaagatg aagatatgga ttcagatgga gatattatga tattggacgc tgaagaagcg       600
     tcgcgtatag gaaagttcaa gacatcatca ttcgaaagaa atgcaaacag gtcatccaga       660
     gatatgggaa actatgaggc accagccaat actggcccat actattcagt accagccgta       720
     aatcctaatg aaatgcatgt tacatataac aacccagctc cggttccaca ttttacgaaa       780
     gatgatggtc cggaggttga aaaattaaac ttccaaagag cacaagaaac cctagaagag       840
     aatgtaaggc gaaaggatga gctcctatat aaacatgaac aactcacctc agattttaca       900
     aaaagtctga gacaagctaa cgaattattg caacatctaa ctttgctaca aagccattta       960
     aaaagagaag agatccaaga aaacagagac gagaatacaa ttttgtctct taaaaatgaa      1020
     atttcattca aaggcgctga atatcataat tttaggcgta gcaaggatgc aaccgccacc      1080
     tctctaagcg gtattgcttc taaactatca tggctaactg tttctatacg agatgccaaa      1140
     tcacgtatcc ataattatgg aaaacataga aatggtgtta atattatcga taatccattt      1200
     gttcttaaca ataattctgg tagaaataat tcagattatg aaaatgaatc aataatgaat      1260
     aatccatttg gaaatatacc tggtttttcg gccaatgtat attcggataa tgatcaacag      1320
     catctccaaa atttattaaa taatataaga cccgacgagg agttggatga agaaggatta      1380
     tcactcactc catctgaatt ggctattacg ttattaaaac accaaagaat gggtcttgcc      1440
     tggttattaa gaatggaaga atctaaatca aaaggtggaa ttttggctga cgatatgggt      1500
     ctaggaaaaa ccgtgcaaac gattgcatta attatggccc ataaatcaga tgacgataat      1560
     cgtaaaacaa atttggtaat agcgccagtg tctttgttga gacaatgggc agctgaaata      1620
     gaatctaaga taaaacctaa tgctcaaatc aaaatagcca tatatcacgg ttcagtgaaa      1680
     aaaaatctcc gtacattcaa ttcgttgaaa aaatatgacg tagttctaac ctcatatggt      1740
     acattatcat ctgaatggaa gaaacattac caaggtccgt tagaggaagc tcgtcttagt      1800
     cggaaccaaa atgtgatccc tgatttagat gcgggaggaa caagttatac ttcacctttt      1860
     tttgcgactg atgctgtttt ctatcgaata attctagacg aagcccagaa tataaaaaat      1920
     aaaagtgcaa ttgcttctaa agcactgtat tgtataaagg gaatccatcg tttttgccta      1980
     tcaggaacac ctatccaaaa caatgttgaa gagctttatc ctattttgag atttttaaga      2040
     atcaaacctt ataatgatga aagcaaattc cgaagtgata tagttttgcc cattagatct      2100
     aaatcttctg gatatgatga ttttgacaag aagaagagta tgcaaaagtt aagggcgtta      2160
     ttgagagcca ttttattaag acgctcgaag aactctttga tagatggaaa gcctattttg      2220
     tctttacccg acaagcttgt cacggaagat acagttcaaa tggaggatga ggaattaaca      2280
     tactacagag aactagaaca aggaattcag aaaaaagcta aaactttatt ggcaagtgaa      2340
     aagttaggtt cgacatctag tattttaact ttattattaa gattaaggca agcttgttgt      2400
     cacagtttct tagttgaaat ggggagaatg aaggccgcgg aatctgaggc taccaagacc      2460
     ttaattacca gagattggaa atcaatgtat gtcaacattc agaagtttga cgaagatacc      2520
     attaatagaa ttagaaatga ggtacatcaa gggaatttac taaaaggcga aaatgaggga      2580
     gaatctaata ctaatagtga tgaagatttg tttacttgcc ctatctgcta tgatgtcttg      2640
     ggttatgaaa gcattgtttt gttttctggt tgtggccata tgatatgtaa taattgtatt      2700
     gaaaactttt tcgaaaggtt tgaaactgga gatggctctg aaggaaaccg actcgcgtct      2760
     tgtttctcgt gttcaaagtc aatcaaggaa aatgagctaa ttgattataa catgttccat      2820
     atgattcatc aggagggcta tgatagggat aaaattgcag aattttataa cataaactat      2880
     tcttctaatg gtaagacaac gaacatgcag aagatacgtc aattgataca agagaataag      2940
     ggattcacgc catctgctaa aatggagaag tgcatgcatt tgataaaaga tgtcttggaa      3000
     aattatccag atgaaaaaat catcattttc tcacaatttt taagtttatt cgatttgatg      3060
     aaacttgttc tagctaatga gaaaatccca tttttgagat atgatggttc tatgtctctt      3120
     gatgaaaaaa atagtactat taagcaattt taccaaggat ctactaaagt tttattgatt      3180
     tcattgagag ctggtaatgt tggtttgacc ttaacctgtg cgtcacatgt tattataatg      3240
     gatccttttt ggaatccata tgttgaggaa caggcaatgg atcgggctca tagaattggt      3300
     cagcaaagag atgttcgtgt acataggatc ttaacagaag gtagcgttga agggcgtatc      3360
     atgactttac agaacgagaa gaaagaaata attagcggtg cactcgatga aaagggaatg      3420
     aaatctgtta gcaagctagg tagacaagag ttggggttct tatttggttt aaatgaattg      3480
     aggtaa                                                                 3486
//

If you have problems or comments...

PBIL Back to PBIL home page