(data stored in ACNUC6288 zone)

EMBL: CR382138.PE246

CR382138.PE246       Location/Qualifiers
FT   CDS_pept        complement(511862..512467)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05698g"
FT                   /old_locus_tag="DEHA0F06204g"
FT                   /old_locus_tag="DEHA-IPF8624"
FT                   /old_locus_tag="DEHA-CDS5349.1"
FT                   /product="DEHA2F05698p"
FT                   /note="similar to uniprot|P39742 Saccharomyces cerevisiae
FT                   YLR292C SEC72 Non-essential subunit of Sec63 complex
FT                   (Sec63p Sec62p Sec66p and Sec72p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88934"
FT                   /db_xref="GOA:Q6BMG2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG2"
FT                   /protein_id="CAG88934.1"
FT                   /translation="MNVALGYDAKTKKISLPDEAEKLVPSLKLEVDQLNTLTSELIANG
FT                   ADVPAPPTQENFNKDMTKMIRKLYEGGVQAFKQGKFQESAKQFTIGIDMICRRHKFEAF
FT                   QGTLQELSLFLMSRADAYLKTKNYLGAFNDADMLLGMMMCTPDNFLRRGVANYFLGNYE
FT                   AARADYQRGLAFDEDNERLVTELEICLDKILEENGDYL"
     atgaacgtag cattaggata cgacgctaag accaaaaaga tatctttacc agatgaggca        60
     gagaagttgg ttccttcgct caaattagaa gttgatcaat tgaatacgtt gaccagtgag       120
     cttatagcta atggagccga tgtaccagca ccaccaacac aggagaattt taataaggac       180
     atgacaaaga tgatcagaaa attgtacgaa ggaggtgttc aggcattcaa gcagggaaag       240
     ttccaagaat ctgctaaaca atttaccatt ggaatcgaca tgatatgtag aagacataaa       300
     ttcgaagcat tccagggcac tttgcaagag ctcagcttat ttcttatgag tagagcggat       360
     gcttatttaa agactaaaaa ctacttaggt gcatttaatg acgctgatat gttacttgga       420
     atgatgatgt gcacacctga taacttcttg agaagaggag tagccaacta cttcttgggt       480
     aattacgaag cggctagagc ggattaccaa agaggattag cgtttgatga agataatgaa       540
     agacttgtaa cagaattaga aatttgttta gataagattc ttgaggaaaa tggtgattat       600
     ctttga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page