(data stored in ACNUC6288 zone)

EMBL: CR382138.PE249

CR382138.PE249       Location/Qualifiers
FT   CDS_pept        516020..516754
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05764g"
FT                   /old_locus_tag="DEHA0F06270g"
FT                   /old_locus_tag="DEHA-IPF8619"
FT                   /old_locus_tag="DEHA-CDS4881.1"
FT                   /product="DEHA2F05764p"
FT                   /note="similar to uniprot|Q03246 Saccharomyces cerevisiae
FT                   YMR188C MRPS17 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88937"
FT                   /db_xref="GOA:Q6BMF9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF9"
FT                   /protein_id="CAG88937.2"
FT                   /translation="MAKQNFIGLVISQGKMSKTVKVRVQTKAYDTKVHKEVIKRKDYLV
FT                   HDEGNLCKEGDIVRIQAIPKISARKYFAIADIKINKGQQFALYESLAKEKVAKEATEKI
FT                   EQFLERRKEYENTIVQVEDLKTLDKLSNTFQSDPSADREFLLSEINAIKEKYNIKSWPS
FT                   TEPVLKLEVNEAAKDLTILQNRVDNIKIILEKLMSEEYASHRQQILSDLSKTPVEELKP
FT                   FTQKNILRKFILDPRNECPVTL"
     atggctaaac aaaatttcat tgggcttgtt atatcgcaag gtaaaatgct gaaaaccgtt        60
     aaggttagag tgcaaaccaa ggcatatgat actaaagttc ataaagaagt cattaaaaga       120
     aaagattact tggttcacga tgaagggaac ctttgtaaag agggagatat agttagaatc       180
     caagctattc ctaagatatc tgccagaaaa tattttgcta ttgctgacat caaaattaac       240
     aaaggtcagc aatttgcatt gtacgaatca ttggccaaag aaaaggttgc gaaggaagca       300
     acagaaaaga tcgagcaatt cttggaaaga agaaaagaat acgagaatac catcgtccaa       360
     gttgaggact tgaaaacttt ggataagttg tcgaatactt tccaaagtga tccatctgca       420
     gacagagagt ttctcttgag cgaaataaat gccattaagg agaaatacaa cattaaatca       480
     tggccttcga ctgagccggt attgaaatta gaagttaatg aggctgccaa ggacttaacc       540
     atacttcaaa acagagtgga taatattaaa attatattgg aaaaacttat gagtgaagaa       600
     tacgcatctc accgtcaaca aatattatcc gacttatcaa agacaccggt tgaagaactc       660
     aagccattta cccaaaagaa tatcttaagg aagtttattt tagatccaag aaatgaatgc       720
     ccggttactt tatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page